DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and adcy2b

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_005170095.1 Gene:adcy2b / 557902 ZFINID:ZDB-GENE-060503-69 Length:1142 Species:Danio rerio


Alignment Length:319 Identity:86/319 - (26%)
Similarity:153/319 - (47%) Gaps:63/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 YANNLEELVEERTQDYHE-------------EKKKCEKLLYQLLPQSVA----AQLISGQPVVAE 947
            |..:|.:|..::|  ||:             ||.:.|:||..|||..:|    |::|  |.:...
Zfish   254 YHKHLMDLALKQT--YHDTCNCIKSPIKLEFEKHQQERLLLSLLPAHIARVMKAEII--QRLKGP 314

  Fly   948 TFDQ-----------------VTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVY 995
            .|.|                 |:|.::||||||.::::.:|.::|..||:|:..||.|.::.|..
Zfish   315 NFSQAENTNNFHNLYVQRHTNVSILYADIVGFTRLASDCSPGELVYMLNELFGKFDQIAKDNDCM 379

  Fly   996 KVETIGDAYMVVSGLP---IRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGAC 1057
            :::.:||.|..|||||   :    .||:...::.|.:.||:.  ::.......:.:|:|:|:|..
Zfish   380 RIKILGDCYYCVSGLPDPLL----DHAKNCVKMGLDMCEAIE--KVREATGVDINMRVGVHSGNV 438

  Fly  1058 VAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVT------TRRGFVP 1116
            :.||:||:..:|.::...|..|:.||:.|...::|||..|.|.|:  |.:..      :|..::.
Zfish   439 LCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLN--GAYKVEQGNGQSRDSYLK 501

  Fly  1117 MKGKGEMLTYWL-----EGEVPRPNSLISPSKLMLTRRSSLKQPQRSQSHNLHKQYSEL 1170
            ..|   ::||.:     |...|...|.|.|:......|:|::..|..:|....|.::.|
Zfish   502 EHG---IVTYLVINPKAEKRSPLLLSAIRPTMYGAKMRASVRMTQYLESWGAAKPFANL 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 16/54 (30%)
CYCc 917..1108 CDD:214485 65/227 (29%)
Guanylate_cyc 944..1130 CDD:278633 57/216 (26%)
adcy2bXP_005170095.1 AC_N <80..307 CDD:292831 16/54 (30%)
CYCc 283..486 CDD:214485 65/212 (31%)
Guanylate_cyc 328..512 CDD:278633 55/194 (28%)
DUF1053 542..646 CDD:283888 4/16 (25%)
CYCc 899..1106 CDD:214485
Guanylate_cyc 929..1128 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.