DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and ACXB

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster


Alignment Length:306 Identity:80/306 - (26%)
Similarity:145/306 - (47%) Gaps:48/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   910 ERTQDYHEE------KKKCEKLLYQLLPQSVA---AQLISGQPVVAET----------------- 948
            :|.|...||      :::...||..:||..:|   .|.|..:.:::||                 
  Fly   235 DRHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENFMA 299

  Fly   949 ---FDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGL 1010
               ...|:|.::|:|.:|.::...|..::|:.|:|||..||.....|.|.:::.:||.|..|:||
  Fly   300 IQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVAGL 364

  Fly  1011 PIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDT 1075
            ...:.: |||....|.::::..:...|.|...:  :.:|||:|:|..:|||:|....:|.::|..
  Fly   365 GEADPD-HARMAVSLGISMIANIQEVRAHRALD--IDMRIGVHSGTLLAGVIGQAKLQYDIWGPD 426

  Fly  1076 VNTASRMESNGEALKIHISETTKEALD--EFGTFVTTR-RGFVPMKGKGEMLTYWLEGEVPRPNS 1137
            |:.|:|:|:.|:...:|:|..|..:|:  |:..|..|. ....|:..|..|.||.|.. .|..||
  Fly   427 VDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEVAQSDPILQKQPMTTYLLTA-APSRNS 490

  Fly  1138 L-----------ISPSKLMLTRRSSLKQPQRSQSHNLHKQYSELVV 1172
            :           |..:.|..:|:|.:.:| ...|..|.:::.::.|
  Fly   491 VRSVDAVHSYAEIDINALGASRKSPILRP-TLMSDELREEFKKMPV 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 9/36 (25%)
CYCc 917..1108 CDD:214485 59/221 (27%)
Guanylate_cyc 944..1130 CDD:278633 58/208 (28%)
ACXBNP_620474.2 AC_N <36..276 CDD:292831 11/40 (28%)
CYCc 249..459 CDD:214485 57/212 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 56/188 (30%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.