DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and Gucy1a1

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_058786.2 Gene:Gucy1a1 / 497757 RGDID:68436 Length:690 Species:Rattus norvegicus


Alignment Length:245 Identity:109/245 - (44%)
Similarity:143/245 - (58%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   868 PDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQ 932
            |..|.|:.::    ...|.....|.|.||:    ..|:..:|...|...|||||...||..:.|.
  Rat   403 PIHNALRDVV----LIGEQARAQDGLKKRL----GKLKATLEHAHQALEEEKKKTVDLLCSIFPS 459

  Fly   933 SVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKV 997
            .||.||..||.|.|:.|::||:.||||||||||.::.:|:||:..||.|||.||......|||||
  Rat   460 EVAQQLWQGQIVQAKKFNEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKV 524

  Fly   998 ETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVV 1062
            |||||||.|..||. |..:.||.:||.:||.::|..:.....|  .:.:|:|||||:|:..||||
  Rat   525 ETIGDAYCVAGGLH-RESDTHAVQIALMALKMMELSNEVMSPH--GEPIKMRIGLHSGSVFAGVV 586

  Fly  1063 GLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRR 1112
            |:|||||||||:.|..|::.||.....||::|.||...|.:...||.|.|
  Rat   587 GVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPR 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944 3/14 (21%)
Pkinase_Tyr 613..877 CDD:285015 3/8 (38%)
HNOBA <893..938 CDD:285003 16/44 (36%)
CYCc 917..1108 CDD:214485 94/190 (49%)
Guanylate_cyc 944..1130 CDD:278633 84/169 (50%)
Gucy1a1NP_058786.2 HNOB <111..234 CDD:285002
HNOBA 276..465 CDD:285003 21/69 (30%)
CYCc 444..633 CDD:214485 95/191 (50%)
Guanylate_cyc 471..642 CDD:278633 84/169 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.