DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and NPR3

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:569 Identity:154/569 - (27%)
Similarity:259/569 - (45%) Gaps:82/569 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGVASIGVGSDEHSFKTPETKNSHKSQSTELVQHFPSLPMPDHRRLGARRQLVFVALLPSVESDN 99
            ||.|.||.|..|.....|:                               ::..:.|||   .|:
Human    33 GGGAGIGGGRQEREALPPQ-------------------------------KIEVLVLLP---QDD 63

  Fly   100 KNDCIMPKVLPVLELAIRHVQRMG-----FVGGSHFDIQLISRDTFCSSKYGPIGFFEIY----- 154
            .....:.:|.|.:|.|:|.|:..|     ...|:.|  |:...|:.|.::    ..|.:.     
Human    64 SYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRF--QVAYEDSDCGNR----ALFSLVDRVAA 122

  Fly   155 TQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNKKSESYSTLTRLKGAQVNNLGN 219
            .:..:.:.:.|..|||..||::|.|..|.:|:|:.|..|..|..|...||.|||:..|.. .:|.
Human   123 ARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYA-KMGE 186

  Fly   220 VVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITRM 284
            ::.|:....:|:|.||:|.::  |::.|  |:..|..:|:..:|..::...:........|:..:
Human   187 MMLALFRHHHWSRAALVYSDD--KLERN--CYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDI 247

  Fly   285 LKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWY--DKNDT 347
            ::|:....|:|||||...:||.|||.|....| .||:|.|.|||||:...| ....|.  ||:|.
Human   248 VRNIQASERVVIMCASSDTIRSIMLVAHRHGM-TSGDYAFFNIELFNSSSY-GDGSWKRGDKHDF 310

  Fly   348 DLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLL 412
            :     |::||:::.|||..:....|:.:.|.|:|: :.||......|.  ::.||..|.|.:||
Human   311 E-----AKQAYSSLQTVTLLRTVKPEFEKFSMEVKS-SVEKQGLNMEDY--VNMFVEGFHDAILL 367

  Fly   413 YANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPT-TGR 476
            |..||:|.:|...:..    :|..::::.|||:|.||.|.|:|||||||...:|::.|... .|.
Human   368 YVLALHEVLRAGYSKK----DGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGT 428

  Fly   477 FEIVAHFL--HNRLEFEANKEIHWAGDREEAPPDRPICGYDGALCPDN-SLPGYAILSIVLGTMV 538
            .|::..:.  ..|.|...|.:..|...:.....:|.:...:.:.|..: .|...|:..||:|.::
Human   429 QEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLEESAVTGIVVGALL 493

  Fly   539 ---VVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDAAERGLRGSF 584
               ::||  |:|..:.|....|..:...:.:|.  ..|:..|..:|..|
Human   494 GAGLLMA--FYFFRKKYRITIERRTQQEESNLG--KHRELREDSIRSHF 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368 127/424 (30%)
ANF_receptor 108..473 CDD:279440 118/376 (31%)
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003
CYCc 917..1108 CDD:214485
Guanylate_cyc 944..1130 CDD:278633
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 126/419 (30%)
ANF_receptor 71..422 CDD:279440 117/375 (31%)
TM_EphA1 476..507 CDD:214014 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3721
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.