DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and Adcy5

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_001012783.3 Gene:Adcy5 / 224129 MGIID:99673 Length:1262 Species:Mus musculus


Alignment Length:244 Identity:79/244 - (32%)
Similarity:132/244 - (54%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   917 EEKKKCE-------KLLYQLLPQSVAAQLISGQPVVAETFDQ----VTIYFSDIVGFT----AIS 966
            |||::.|       :||:.:||:.|||..::.:....|.:.|    |.:.|:.|..|:    .:.
Mouse  1025 EEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELE 1089

  Fly   967 AESTPMQVVQFLNDLYTCFDSIV--ENF-DVYKVETIGDAYMVVSGLP----IRNGNQHAREIAR 1024
            |.:..::.::.||::...||.|:  :.| .:.|::|||..||..|||.    .:.|..|.:.||.
Mouse  1090 ANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKAGKTHIKAIAD 1154

  Fly  1025 LALALLEAV-----HNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMES 1084
            .|:.|::.:     |:|       :..:::|||:.|..||||:|.:.|:|.::|:|||.||||:|
Mouse  1155 FAMKLMDQMKYINEHSF-------NNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDS 1212

  Fly  1085 NGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGEVP 1133
            .|...:|.::....:.| ...|:....||.|.:||||||:||:|.|..|
Mouse  1213 TGVPDRIQVTTDMYQVL-AANTYQLECRGVVKVKGKGEMMTYFLNGGPP 1260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 11/27 (41%)
CYCc 917..1108 CDD:214485 65/217 (30%)
Guanylate_cyc 944..1130 CDD:278633 66/205 (32%)
Adcy5NP_001012783.3 AC_N 1..459 CDD:292831
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194
CYCc 425..620 CDD:214485
Guanylate_cyc 461..622 CDD:278633
DUF1053 669..761 CDD:283888
CYCc 1037..1238 CDD:214485 61/208 (29%)
Guanylate_cyc 1063..1257 CDD:278633 65/201 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.