DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and gcy-36

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_510557.3 Gene:gcy-36 / 191657 WormBaseID:WBGene00001556 Length:675 Species:Caenorhabditis elegans


Alignment Length:283 Identity:111/283 - (39%)
Similarity:154/283 - (54%) Gaps:35/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   897 MELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVG 961
            ::|.|||  |.:|...:|...||.|.:.||.::||.|||.||..|..|.|..:::.|:.|:|:..
 Worm   396 LQLEANN--EQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEEATVMFTDVPT 458

  Fly   962 FTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLA 1026
            |..|....||..:|..||:|:|.||.::.....|||||:||:||.|.|:| ...:.|...|..||
 Worm   459 FQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAYKVETVGDSYMSVGGIP-DLVDDHCEVICHLA 522

  Fly  1027 LALL-------EAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMES 1084
            |.::       :.:.|..:|        :|.|:|:|..||||||.||||||||||||||:|||||
 Worm   523 LGMVMEARTVCDPITNTPLH--------IRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMES 579

  Fly  1085 NGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGEVPRPNSLISPSKLMLTRR 1149
            :....:||.||..|:..:..|.|....||.|.:||||||.||:|               |...:|
 Worm   580 HSPIGRIHCSENAKKCAESTGRFEFEPRGRVQIKGKGEMNTYFL---------------LRSFKR 629

  Fly  1150 S--SLKQPQRSQSHNLHKQYSEL 1170
            |  .:...:|.::.|....|:||
 Worm   630 SIWEIIDRRRDENCNSIDGYNEL 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 17/40 (43%)
CYCc 917..1108 CDD:214485 83/197 (42%)
Guanylate_cyc 944..1130 CDD:278633 83/192 (43%)
gcy-36NP_510557.3 HNOB 3..167 CDD:285002
HNOBA 217..435 CDD:285003 17/40 (43%)
CYCc 415..604 CDD:214485 84/197 (43%)
Guanylate_cyc 441..624 CDD:278633 83/206 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.