DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and Npr3

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:560 Identity:151/560 - (26%)
Similarity:265/560 - (47%) Gaps:85/560 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLLLI---LCLLQAHLFPSAAWFYDAESVGGVASIGVGSDEHSFKTPETKNSHKSQSTELVQHFP 70
            ||||.   .|:|.|.:.           :.|.||.|.|         :|:...:.::.|.:    
Mouse     3 SLLLFTFSACVLLARVL-----------LAGGASSGAG---------DTRPGSRRRAREAL---- 43

  Fly    71 SLPMPDHRRLGARRQLVFVALLPSVESDNKNDCIMPKVLPVLELAIRHVQRMG-----FVGGSHF 130
                       |.:::..:.|||   .|:.....:.:|.|.:|.|:|.|:..|     ...|:.|
Mouse    44 -----------AAQKIEVLVLLP---RDDSYLFSLARVRPAIEYALRSVEGNGTGRKLLPPGTRF 94

  Fly   131 DIQLISRDTFCSSKYGPIGFFEIY-----TQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTG 190
              |:...|:.|.::    ..|.:.     .:..:.:.:.|..|||..||::|.|..|.:|:|:.|
Mouse    95 --QVAYEDSDCGNR----ALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAG 153

  Fly   191 GNAKEFNKKSESYSTLTRLKGAQVNNLGNVVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLA 255
            ..|..|..|...||.|||:..|.. .:|.::.|:....:|:|.||:|.::  |::.|  |:..|.
Mouse   154 ALAAGFQHKDTEYSHLTRVAPAYA-KMGEMMLALFRHHHWSRAALVYSDD--KLERN--CYFTLE 213

  Fly   256 AIHDTIEEHSVYQLGFDTSTWTKADITRMLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSG 320
            .:|:..:|..::...::.......|:..:::.:....|:|||||...:||:|||......| .||
Mouse   214 GVHEVFQEEGLHTSAYNFDETKDLDLDDIVRYIQGSERVVIMCASGDTIRRIMLAVHRHGM-TSG 277

  Fly   321 EYVFINIELFSRVQYLTSQPWY--DKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKA 383
            :|.|.|||||:...| ....|.  ||:|::     |::||:::.|||..:....|:.:.|.|:|:
Mouse   278 DYAFFNIELFNSSSY-GDGSWRRGDKHDSE-----AKQAYSSLQTVTLLRTVKPEFEKFSMEVKS 336

  Fly   384 IAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTG 448
             :.||..  .::.:.::.||..|.|.:|||..||:|.:|...:..    :|..::::.|||:|.|
Mouse   337 -SVEKQG--LNEEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKK----DGGKIIQQTWNRTFEG 394

  Fly   449 ITGNVTIDANGDRLSAYSLLDMNPT-TGRFEIVAHFL--HNRLEFEANKEIHWAGDREEAPPDRP 510
            |.|.|:|||||||...:|::.|..| .|..|::..:.  ..|.:..:|.:..|...:......|.
Mouse   395 IAGQVSIDANGDRYGDFSVVAMTDTEAGTQEVIGDYFGKEGRFQMRSNVKYPWGPLKLRLDETRI 459

  Fly   511 ICGYDGALCPDN-SLPGYAILSIVLGTMV---VVMAVCFF 546
            :...:.:.|..: .|...|:..||:|.::   ::||..||
Mouse   460 VEHTNSSPCKSSGGLEESAVTGIVVGALLGAGLLMAFYFF 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368 124/424 (29%)
ANF_receptor 108..473 CDD:279440 115/376 (31%)
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003
CYCc 917..1108 CDD:214485
Guanylate_cyc 944..1130 CDD:278633
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 123/418 (29%)
ANF_receptor 66..419 CDD:279440 115/377 (31%)
TM_EphA1 471..502 CDD:214014 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 171 1.000 Domainoid score I3744
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.