DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and acy-4

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 / 178949 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans


Alignment Length:257 Identity:80/257 - (31%)
Similarity:128/257 - (49%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   895 KRMELYAN-----NLEELVEE-RTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVA----ETF 949
            :|.||.:.     .|:.|.|: :.:..||:.:   .:|..:||..||...:.....|:    |:.
 Worm   751 RRSELISRYDFIWKLQALDEQLQMKRKHEQNR---SVLENILPSHVAKHFVEDATSVSKLYHESR 812

  Fly   950 DQVTIYFSDIVGFTAISAE----STPMQVVQFLNDLYTCFDSIVENF-------DVYKVETIGDA 1003
            |...|.|:.:..|.....|    :..::.::.||::.:.||.|::..       .:.|::||...
 Worm   813 DNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTT 877

  Fly  1004 YMVVSGLPIR--NGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKM 1066
            |||.|||..|  ..|.|...||..|..||..:.:..||  ..:...||||::.|..||||:|...
 Worm   878 YMVASGLAGRECGDNSHVEAIALFARELLVKLESTNIH--SFNNFNLRIGINVGPVVAGVIGSDK 940

  Fly  1067 PRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWL 1128
            |.|.::|::||.||||:|.|.|.:|.::|..|..|:..| :....||.:.:||||.|.|::|
 Worm   941 PHYDIWGNSVNVASRMDSGGVAGRIQVTEEVKSILEPLG-YNFECRGQINVKGKGMMETFFL 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 13/48 (27%)
CYCc 917..1108 CDD:214485 64/207 (31%)
Guanylate_cyc 944..1130 CDD:278633 67/202 (33%)
acy-4NP_504486.4 AC_N <50..291 CDD:292831
CYCc 260..451 CDD:214485
Guanylate_cyc 293..448 CDD:278633
CYCc 778..984 CDD:214485 65/211 (31%)
Guanylate_cyc 807..1003 CDD:278633 66/198 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.