DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and acy-1

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_497970.1 Gene:acy-1 / 175622 WormBaseID:WBGene00000068 Length:1253 Species:Caenorhabditis elegans


Alignment Length:472 Identity:112/472 - (23%)
Similarity:189/472 - (40%) Gaps:110/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   874 KSMIRRFNKDNET------------GNIVDNLLK-----RMELYANNLEELVEERTQDYHEEKKK 921
            :||:.|.:.:.||            ..:.|.|||     |....:|:........||        
 Worm   236 QSMLARKDLELETQFKDHMIQSVMPKKVADELLKDASELRRPSASNDSNCRTSNATQ-------- 292

  Fly   922 CEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFD 986
            .::.|.:::|     :....:|........|:|.|:||.|||.:|:..:..::|..||||:..||
 Worm   293 VDQPLAKMVP-----EYRKFRPFTMNLMTNVSILFADIAGFTKMSSNKSADELVNLLNDLFGRFD 352

  Fly   987 SIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIG 1051
            ::.....:.|:.|:||.|..|:|.| ...:.||.....:.|.::.|:..|.|....|  :.:|:|
 Worm   353 TLCRLRGLEKISTLGDCYYCVAGCP-EPCDDHACRTVEMGLDMIVAIRQFDIDRGQE--VNMRVG 414

  Fly  1052 LHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETT----------KEALDEFGT 1106
            :|||..:.|:||.|..::.:|.:.|..|:.|||:|.|.::|:||.|          :|..|..|.
 Worm   415 IHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSGVAGRVHVSEATAKLLKGLYEIEEGPDYDGP 479

  Fly  1107 FVTTRRGFVPMKGKGEMLTYWLEGEVPRPNSLISPSKLMLTRRSSLKQPQRSQSHNLHKQYSELV 1171
            .....:|.........|.|::::|.:   |..:....:.:....||...:.|:...|.::::|.:
 Worm   480 LRMQVQGTERRVKPESMKTFFIKGRI---NDGVEEEVMQVQEVESLHSQKSSKKSTLKQKWAEKL 541

  Fly  1172 VASPPPQLPPPAIALPPPPSPSKDSPNLRVK------------------------RKISS----S 1208
            ..:.....|..|.|       .:...:||:|                        ||.:|    :
 Worm   542 KMNHTNSYPMRAAA-------REGGGSLRIKLAERNRSTQLLPKESNSICIMEDNRKSASLQALA 599

  Fly  1209 SPKLNGGGFDYHKTENHYLD----------TAAAAQRNCDIYSSRS----LRDMEETSDSWELAH 1259
            :...||...|   |.|.|.:          :.|.::.| .|..|||    |...:..||      
 Worm   600 TNNFNGSNTD---TNNTYSERGVAGSVSKKSVAGSESN-SIKGSRSSGLQLSLQDGNSD------ 654

  Fly  1260 FRLPLSGALK---SHHH 1273
              |...|.|.   ||||
 Worm   655 --LNSVGGLDTAISHHH 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944 3/8 (38%)
Pkinase_Tyr 613..877 CDD:285015 1/2 (50%)
HNOBA <893..938 CDD:285003 9/49 (18%)
CYCc 917..1108 CDD:214485 58/200 (29%)
Guanylate_cyc 944..1130 CDD:278633 58/195 (30%)
acy-1NP_497970.1 MreD 127..>223 CDD:294686
CYCc 297..469 CDD:214485 55/179 (31%)
Guanylate_cyc 317..503 CDD:278633 58/188 (31%)
SDF <773..982 CDD:294387
CYCc 1016..1215 CDD:214485
Guanylate_cyc 1041..1235 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.