DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and gcy-35

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_001252131.1 Gene:gcy-35 / 173202 WormBaseID:WBGene00001555 Length:688 Species:Caenorhabditis elegans


Alignment Length:322 Identity:128/322 - (39%)
Similarity:177/322 - (54%) Gaps:41/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   872 TLKSMIRR------FNKDNETGNIVDNLLKRMELYANNLEELVEERT-------QDYHEEKKKCE 923
            |::.:|.|      ..:.:.|.:::  :|.:..:....|...:||.|       |:...||:|.:
 Worm   332 TVRELIERNLHLSDMQRHDGTRDVI--MLNQSRMSQVELNRTLEETTKKLKKMAQELEIEKQKTD 394

  Fly   924 KLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSI 988
            :||.:|:|.|||..|.||:.:.|:.|...|:.|:|||.||.|.|..||..||..|||||..||.:
 Worm   395 ELLCELMPASVADSLRSGKAMDAKEFADCTLLFTDIVTFTNICAMCTPYDVVTLLNDLYLRFDRL 459

  Fly   989 VENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALL--EAVHNFRIHHRPEDRLKLRIG 1051
            |...|.|||||||||||:|.|:|.|..| ||..:..:::.:|  ..:....|.|:|   :|:|:|
 Worm   460 VGLHDAYKVETIGDAYMIVGGVPERCEN-HAERVLNISIGMLMESKLVLSPITHKP---IKIRLG 520

  Fly  1052 LHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTK-EALDEFGTFVTTRRGFV 1115
            :|.|..||||||:|||||||||||||.|::|||||...|||:|||.| ..|....::|...||..
 Worm   521 VHCGPVVAGVVGIKMPRYCLFGDTVNVANKMESNGIQCKIHVSETGKLNGLKANPSYVFIDRGNT 585

  Fly  1116 PMKGKGEMLTYWLEGEVPRPNSLISPSKLMLTRRS--------------SLKQPQRSQSHNL 1163
            .::|||.|.||:||     .|...|..:|....||              |:.|.:..|..||
 Worm   586 EIRGKGMMYTYFLE-----RNDRKSVWELCSRPRSGEQTIDGYMELHDQSIYQEEGGQQENL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944 3/16 (19%)
Pkinase_Tyr 613..877 CDD:285015 1/4 (25%)
HNOBA <893..938 CDD:285003 16/51 (31%)
CYCc 917..1108 CDD:214485 97/193 (50%)
Guanylate_cyc 944..1130 CDD:278633 94/188 (50%)
gcy-35NP_001252131.1 HNOB 3..167 CDD:285002
HNOBA 218..409 CDD:285003 20/78 (26%)
CYCc 388..579 CDD:214485 97/194 (50%)
Guanylate_cyc 415..599 CDD:278633 93/187 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.