DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and Adcy9

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_011244107.1 Gene:Adcy9 / 11515 MGIID:108450 Length:1372 Species:Mus musculus


Alignment Length:437 Identity:106/437 - (24%)
Similarity:183/437 - (41%) Gaps:96/437 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   889 IVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVT 953
            |.|:|:|:.:..:.|  .:....|......|||          .|:....|:.:|...:..::|:
Mouse   342 IADDLMKQGDEESEN--SVKRHATSSPKNRKKK----------SSIQKAPIAFRPFKMQQIEEVS 394

  Fly   954 IYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQH 1018
            |.|:||||||.:||..:...:|..||||:..||.:.|.....|:.|:||.|..|:|.|....: |
Mouse   395 ILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRAD-H 458

  Fly  1019 AREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRME 1083
            |.....:.|.:::|:..|  ....::.:.:|:|:|||..:.|::|::..::.::.:.||.|:.||
Mouse   459 AYCCIEMGLGMIKAIEQF--CQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLME 521

  Fly  1084 SNGEALKIHISETTKEALDE------------FGTFVTTRRGFVPMKGKGEMLTYWLEGEVPRPN 1136
            ..|.|.|:||||.|.:.||:            .|..|...:    :||   :.||.:.|:..: .
Mouse   522 QLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSVVADQ----LKG---LKTYLISGQRAK-E 578

  Fly  1137 SLISPSKLML--------TRRSSLKQPQRSQSHNLHKQYSELVVASPPPQLPPPAIALPPPPSPS 1193
            |..|.::.:|        :|.||..:.|.:.|.......::.|......:..|.......|.|.:
Mouse   579 SHCSCAEALLSGFEVIDDSRESSGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEA 643

  Fly  1194 -----------KDSPNLRVKRKISSS------------SPKLNGGGFDYHKTENHYLDTAAAAQR 1235
                       :|.|  :...|::||            .||.:||  ...||:|..|...|..:.
Mouse   644 GAEGGTVQNGCQDEP--KTSTKVTSSWLLFLSVPLLAHPPKASGG--PNSKTQNGLLSPPAEEKL 704

  Fly  1236 N------CDIYSSRS----------------LRDMEETSDSWELAHF 1260
            .      |:|...:.                .:::.|.:|    |||
Mouse   705 TNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNIREKTD----AHF 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 8/44 (18%)
CYCc 917..1108 CDD:214485 61/202 (30%)
Guanylate_cyc 944..1130 CDD:278633 60/197 (30%)
Adcy9XP_011244107.1 MFS <134..260 CDD:391944
Guanylate_cyc 385..573 CDD:306677 60/197 (30%)
Guanylate_cyc 1069..1260 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.