DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and ADCY7

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_011521137.1 Gene:ADCY7 / 113 HGNCID:238 Length:1086 Species:Homo sapiens


Alignment Length:269 Identity:82/269 - (30%)
Similarity:136/269 - (50%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   894 LKRMELYANNLEELVEERTQDYHEEKKKCEK----LLYQLLPQSVAAQLIS---GQPVVAETFDQ 951
            |.|...|...|:.|.:::.:..|||.:..|.    ||..:||..|||..|.   .:....:::|.
Human   813 LSRQIDYYCRLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDC 877

  Fly   952 VTIYFSDI----VGFTAISAESTPMQVVQFLNDLYTCFDSIV--ENFD-VYKVETIGDAYMVVSG 1009
            |.:.|:.:    |.:|........::.::.||::...||.::  ..|. |.|::|||..||..:|
Human   878 VCVMFASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAG 942

  Fly  1010 LPIRNGN-------QHAR--EIARLALALLEAV-----HNFRIHHRPEDRLKLRIGLHTGACVAG 1060
            |.:.:|:       |||.  .:...::||:..:     |:|       :..:||:|::.|..:||
Human   943 LSVASGHENQELERQHAHIGVMVEFSIALMSKLDGINRHSF-------NSFRLRVGINHGPVIAG 1000

  Fly  1061 VVGLKMPRYCLFGDTVNTASRMESNGEALKIHIS------ETTKEALDEFGTFVTTRRGFVPMKG 1119
            |:|.:.|:|.::|:|||.||||||.||..||.:|      |.|...|...| :....||.:.:||
Human  1001 VIGARKPQYDIWGNTVNVASRMESTGELGKIQVSLPFQVTEETCTILQGLG-YSCECRGLINVKG 1064

  Fly  1120 KGEMLTYWL 1128
            |||:.||::
Human  1065 KGELRTYFV 1073

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 16/47 (34%)
CYCc 917..1108 CDD:214485 67/224 (30%)
Guanylate_cyc 944..1130 CDD:278633 65/212 (31%)
ADCY7XP_011521137.1 AC_N <73..249 CDD:292831
CYCc 224..429 CDD:214485
Guanylate_cyc 270..432 CDD:278633
DUF1053 485..592 CDD:283888
CYCc 848..1052 CDD:214485 64/211 (30%)
Guanylate_cyc 871..1073 CDD:278633 65/209 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.