DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and ADCY6

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_001377760.1 Gene:ADCY6 / 112 HGNCID:237 Length:1168 Species:Homo sapiens


Alignment Length:248 Identity:80/248 - (32%)
Similarity:133/248 - (53%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   898 ELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQ----VTIYFSD 958
            :|.|...:|.:|| .|.|:      .:||:.:||:.|||..::.:....|.:.|    |.:.|:.
Human   927 KLQATGEKEEMEE-LQAYN------RRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFAS 984

  Fly   959 IVGFT----AISAESTPMQVVQFLNDLYTCFDSIV--ENF-DVYKVETIGDAYMVVSGLPIRN-- 1014
            |..|:    .:.|.:..::.::.||::...||.|:  |.| .:.|::|||..||..|||....  
Human   985 IANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYD 1049

  Fly  1015 --GNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVN 1077
              |..|...:|..|:.|:|.:.:  |:....:..:::|||:.|..||||:|.:.|:|.::|:|||
Human  1050 QVGRSHITALADYAMRLMEQMKH--INEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVN 1112

  Fly  1078 TASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEG 1130
            .:|||:|.|...:|.::....:.|...| :....||.|.:||||||.||:|.|
Human  1113 VSSRMDSTGVPDRIQVTTDLYQVLAAKG-YQLECRGVVKVKGKGEMTTYFLNG 1164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 14/39 (36%)
CYCc 917..1108 CDD:214485 60/205 (29%)
Guanylate_cyc 944..1130 CDD:278633 65/200 (33%)
ADCY6NP_001377760.1 AC_N <16..368 CDD:318454
Guanylate_cyc 370..554 CDD:306677
DUF1053 582..668 CDD:399378
Guanylate_cyc 970..1164 CDD:306677 64/196 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.