DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and ADCY2

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens


Alignment Length:372 Identity:99/372 - (26%)
Similarity:167/372 - (44%) Gaps:71/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 PFYLGRCA-------------YEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRR 858
            |:::..|.             ||.....::..:.|||...:.            |.|.:.|...:
Human   738 PYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLH------------THAHVLGDYSQ 790

  Fly   859 CWAEDPAERPDFNTLKSM-IRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKC 922
            ...|.|....|..|:.|: :..|       .|...:|.|...|...|:.|.:.:.:...||.:..
Human   791 VLFERPGIWKDLKTMGSVSLSIF-------FITLLVLGRQNEYYCRLDFLWKNKFKKEREEIETM 848

  Fly   923 EK----LLYQLLPQSVA----AQLISGQPVVAETFDQVTIYFSDIVGFTAISAES----TPMQVV 975
            |.    ||..:||..||    |:.:..:.:..:::|.|.:.|:.|..|.....||    ..::.:
Human   849 ENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECL 913

  Fly   976 QFLNDLYTCFDSIVEN---FDVYKVETIGDAYMVVSGLPIRNGNQHARE----------IARLAL 1027
            :.||::...||.::..   ..|.|::|||..||..:||......:|::|          :...|.
Human   914 RLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGTMVEFAF 978

  Fly  1028 AL---LEAV--HNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGE 1087
            ||   |:|:  |:|       :..|||:|::.|..:|||:|.:.|:|.::|:|||.||||:|.|.
Human   979 ALVGKLDAINKHSF-------NDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGV 1036

  Fly  1088 ALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGEVPR 1134
            ..||.::|.|...|...| :..|.||.:.:||||::.||::..|:.|
Human  1037 LDKIQVTEETSLVLQTLG-YTCTCRGIINVKGKGDLKTYFVNTEMSR 1082

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944 16/89 (18%)
Pkinase_Tyr 613..877 CDD:285015 15/83 (18%)
HNOBA <893..938 CDD:285003 15/52 (29%)
CYCc 917..1108 CDD:214485 66/220 (30%)
Guanylate_cyc 944..1130 CDD:278633 65/207 (31%)
ADCY2NP_065433.2 AC_N <33..260 CDD:292831
CYCc 236..439 CDD:214485
Guanylate_cyc 281..465 CDD:278633
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485 64/215 (30%)
Guanylate_cyc 878..1077 CDD:278633 65/206 (32%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922 2/16 (13%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.