DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and Adcy4

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_001348533.1 Gene:Adcy4 / 104110 MGIID:99674 Length:1077 Species:Mus musculus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:136/275 - (49%) Gaps:38/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 LLKRMELYANNLEELVEERTQDYHEEKKKCEK----LLYQLLPQSVAAQLIS----GQPVVAETF 949
            :|.|...|...|:.|.:::.:...||.:..|.    ||..:||..||.|.|.    .:.:..:::
Mouse   807 VLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSY 871

  Fly   950 DQVTIYFSDIVGFTAISAEST----PMQVVQFLNDLYTCFDSIVEN---FDVYKVETIGDAYMVV 1007
            :.|.:.|:.:..|....:||.    .::.::.||::...||.::..   ..|.|::|||..||..
Mouse   872 ECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAA 936

  Fly  1008 SGLPIRNGN----------QHAREIARLALALLEAV-----HNFRIHHRPEDRLKLRIGLHTGAC 1057
            :||...:|.          .|...:...|:||...:     |:|       :..:||:||:.|..
Mouse   937 TGLNATSGQDTQQDSERSCSHLGTMVEFAVALGSKLGVINKHSF-------NNFRLRVGLNHGPV 994

  Fly  1058 VAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGE 1122
            ||||:|.:.|:|.::|:|||.||||||.|...||.::|.|..||...| :....||.:.:|||||
Mouse   995 VAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLG-YTCYSRGSIKVKGKGE 1058

  Fly  1123 MLTYWLEGEVPRPNS 1137
            :.||:|..::.|..|
Mouse  1059 LCTYFLNTDLTRTGS 1073

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 14/48 (29%)
CYCc 917..1108 CDD:214485 66/220 (30%)
Guanylate_cyc 944..1130 CDD:278633 65/207 (31%)
Adcy4NP_001348533.1 AC_N <115..246 CDD:318454
Guanylate_cyc 264..418 CDD:306677
DUF1053 479..580 CDD:368844
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..524
Guanylate_cyc 866..1065 CDD:306677 64/206 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.