DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and npr3

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_004910476.1 Gene:npr3 / 100495974 XenbaseID:XB-GENE-1012470 Length:508 Species:Xenopus tropicalis


Alignment Length:475 Identity:144/475 - (30%)
Similarity:236/475 - (49%) Gaps:50/475 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VALLPSVESDNKNDCIMPKVLPVLELAIRHVQ-RMGFVGGSHFDIQLISRDTFCSSKYGPIGFFE 152
            :.|||   .||.....|.:|.|.::.|:|.:| ....:.|.||::  |..|:.|.:: ......:
 Frog    30 LVLLP---KDNSYMFSMDRVRPAVDHALRSIQENQTLLPGMHFNV--IYNDSDCGNQ-ALFSLID 88

  Fly   153 IYTQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNKKSESYSTLTRLKGAQVNNL 217
            |..|..:.:.:.|..|||..||::|.|..|.||:|:.|..|..|.:||..||.|||:... .:.:
 Frog    89 IAMQLQKPDVILGPVCEYAAAPVARLASHWNVPMLSAGALAIGFMQKSNEYSHLTRVSPV-YSKM 152

  Fly   218 GNVVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTK-ADI 281
            |.:..|:.....||:..|:|.::|.:..    ||..|..:|...:|.. |.:.......|| .|.
 Frog   153 GEMFLAMFRYHKWTKAFLLYTDDNLQRN----CFFTLEGVHLAFKEEG-YAMSIHNFDETKHVDA 212

  Fly   282 TRMLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWY--DK 344
            ..::.::..:.|:|||||...::|.|||.|....| .:|:|||.|||||:...| .:..|.  ||
 Frog   213 EEIVHSIQNKERVVIMCASSDTVRNIMLAAHRQGM-TNGDYVFFNIELFNSSTY-GNGSWKRGDK 275

  Fly   345 NDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDG 409
            .|.:     |::||:::.|||..:....|:.:.|.|:|: :.:|..  .::::.::.||..|.|.
 Frog   276 YDLE-----AKQAYSSLQTVTLLRTVKPEFEKFSMEVKS-SVQKLG--LNEDDYVNMFVEGFHDA 332

  Fly   410 VLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDM-NPT 473
            ::|||.||:|.::...:..    :|..:|::||||::.||.|.|:|||||||...:|::.| :..
 Frog   333 IILYALALHELLKNGFSKK----DGEKLVQQMWNRTYEGIAGQVSIDANGDRYGDFSVIAMTDKE 393

  Fly   474 TGRFEIVAHF--LHNRLEFEANKEIHWAGDR-------EEAPPDRPICGYDGALCPDNSLPGYAI 529
            ||..|::..:  :....|...|.:..|...|       .|.|...| |...|.|...      |:
 Frog   394 TGTQEVIGDYYGIQGHFEIRPNVKPPWGPGRLLINERIVEHPSTTP-CKSSGGLGES------AV 451

  Fly   530 LSIVLGTMV---VVMAVCFF 546
            ..||:|..:   ::||..||
 Frog   452 TGIVVGAFLGTGLLMAFYFF 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368 128/415 (31%)
ANF_receptor 108..473 CDD:279440 117/369 (32%)
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003
CYCc 917..1108 CDD:214485
Guanylate_cyc 944..1130 CDD:278633
npr3XP_004910476.1 PBP1_NPR_C 25..414 CDD:380609 127/409 (31%)
TM_EphA1 443..474 CDD:391457 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.