DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and adcy1

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_002933461.1 Gene:adcy1 / 100492373 XenbaseID:XB-GENE-950909 Length:1122 Species:Xenopus tropicalis


Alignment Length:248 Identity:78/248 - (31%)
Similarity:129/248 - (52%) Gaps:23/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   909 EERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQP----VVAETFDQVTIYFSDIVGFT----AI 965
            ||...|....|...:::|:.|||..||...:...|    :..:::.||.:.|:.|..|.    .:
 Frog   811 EEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIEL 875

  Fly   966 SAESTPMQVVQFLNDLYTCFDSIVEN---FDVYKVETIGDAYMVVSGLPIRNGNQ-------HAR 1020
            ...:..::.::.||::...||.::|.   .|:.|::|||..||...||....|.:       |..
 Frog   876 DGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLS 940

  Fly  1021 EIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESN 1085
            .:|..::.:.:.:.  .|:::..:...||:|::.|..||||:|.:.|:|.::|:|||.||||:|.
 Frog   941 TLADFSIEMFDVLD--EINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDST 1003

  Fly  1086 GEALKIHISETTKEALDEFG-TFVTTRRGFVPMKGKGEMLTYWLEGEVPRPNS 1137
            |...||.::|.....|.... .||.  ||.|.:|||||||||:|||::...||
 Frog  1004 GVQGKIQVTEDVHRILKSCNYEFVC--RGKVSVKGKGEMLTYFLEGKIDGTNS 1054

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 10/28 (36%)
CYCc 917..1108 CDD:214485 56/209 (27%)
Guanylate_cyc 944..1130 CDD:278633 63/200 (32%)
adcy1XP_002933461.1 AC_N <37..282 CDD:292831
CYCc 248..443 CDD:214485
Guanylate_cyc 284..466 CDD:278633
CYCc 817..1028 CDD:214485 57/212 (27%)
Guanylate_cyc 850..1047 CDD:278633 63/200 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.