DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and LOC100333871

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:XP_002666572.2 Gene:LOC100333871 / 100333871 -ID:- Length:243 Species:Danio rerio


Alignment Length:246 Identity:129/246 - (52%)
Similarity:166/246 - (67%) Gaps:20/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   929 LLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFD 993
            :||:.||..|..|:|:.|:::...|::||||||||.:|:.|||.|||.|||.|||.||.|::|.|
Zfish     1 MLPKQVADDLRLGKPMQAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHD 65

  Fly   994 VYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACV 1058
            ||||||||||||||||:|..||..||.|||.:||.|:.....|||.|||:.:|::|.|:|:|..|
Zfish    66 VYKVETIGDAYMVVSGVPRENGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVV 130

  Fly  1059 AGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEM 1123
            |||||.||||||||||||||||||||..|||||..|.:....|:|.|.::.|.||.:.:||||:|
Zfish   131 AGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEIGGYLLTCRGLLQVKGKGDM 195

  Fly  1124 LTYWLEGEVPRPNSLISPSKLMLTRRSSLKQP---QRSQSHNLHKQ-YSEL 1170
            :||||||:..:                .:|:|   |.|:.....|: ||.:
Zfish   196 VTYWLEGKCSK----------------DMKKPATQQESEKPEAEKEDYSSI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 4/8 (50%)
CYCc 917..1108 CDD:214485 108/178 (61%)
Guanylate_cyc 944..1130 CDD:278633 113/185 (61%)
LOC100333871XP_002666572.2 CYCc 1..179 CDD:214485 108/177 (61%)
Guanylate_cyc 16..202 CDD:278633 113/185 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123766at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.