DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31183 and adcy8

DIOPT Version :9

Sequence 1:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_001137224.1 Gene:adcy8 / 100148976 ZFINID:ZDB-GENE-070912-197 Length:1225 Species:Danio rerio


Alignment Length:298 Identity:93/298 - (31%)
Similarity:157/298 - (52%) Gaps:31/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 YANNLEEL----VEERTQDYHEEKKKCEKLLYQLLPQSVAAQLI----SGQPVVAETFDQVTIYF 956
            |...|:.|    .:|...:..|.::..|.:|..:||..||...:    ..:.:.::::|.|.:.|
Zfish   896 YTARLDFLWRVQAKEEINEMRELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDTVGVMF 960

  Fly   957 SDIVGFTAISAE----STPMQVVQFLNDLYTCFDSIV--ENF-DVYKVETIGDAYMVVSGL-PIR 1013
            :.|.||....::    :..::.::.||::...||.::  |.| |:.|::|||..||.|||| |.:
Zfish   961 ASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEERFQDIEKIKTIGSTYMAVSGLSPEK 1025

  Fly  1014 NGNQ----HAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGD 1074
            ...:    |...:|..|:||.|::.....|  ..:..:||||:..|:.||||:|.|.|:|.::|.
Zfish  1026 QQCEDKWGHLCALADFAIALNESIQEINKH--SFNNFQLRIGMAHGSVVAGVIGAKKPQYDIWGK 1088

  Fly  1075 TVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKG----KGEMLTYWLEGEVPRP 1135
            |||.||||:|.|.:.||.:.|.|...|:|.| |....||.:.:||    :|::.|:::.|.| :|
Zfish  1089 TVNLASRMDSTGVSGKIQLPEETYAILNERG-FAFEYRGEIYVKGISEQEGKIRTHFMIGRV-QP 1151

  Fly  1136 NSLI-SPSKLMLTRRSSLKQPQRSQSHNLHKQYSELVV 1172
            |.|| .|.|  ||.:.||.........:|::|..:.::
Zfish  1152 NPLILQPRK--LTGQYSLAAVVLGLVQSLNRQKQKQIL 1187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 11/41 (27%)
CYCc 917..1108 CDD:214485 68/206 (33%)
Guanylate_cyc 944..1130 CDD:278633 68/201 (34%)
adcy8NP_001137224.1 AC_N <135..374 CDD:292831
CYCc 340..538 CDD:214485
Guanylate_cyc 379..563 CDD:278633
DUF1053 592..685 CDD:283888
CYCc 919..1123 CDD:214485 68/206 (33%)
Guanylate_cyc 948..1147 CDD:278633 68/201 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.