DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4546 and AT2G14045

DIOPT Version :9

Sequence 1:NP_650501.1 Gene:CG4546 / 41922 FlyBaseID:FBgn0038373 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001324165.1 Gene:AT2G14045 / 815889 AraportID:AT2G14045 Length:122 Species:Arabidopsis thaliana


Alignment Length:137 Identity:39/137 - (28%)
Similarity:67/137 - (48%) Gaps:32/137 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ESKRVQYRKYLERAGVIDALSKALIKLYEEQNKPEDAIRFVRKFMCESCPDDAQYDVMKNDLEEA 69
            |.|:..:|||||.:||:|:|:|.|:.|||:.:||..|:.|:::.:  ..|..:.|:.::.:..:.
plant     9 EVKKEAFRKYLESSGVLDSLTKVLVSLYEQNDKPSSALEFIQQKL--GGPSVSDYEKLQAEKSDL 71

  Fly    70 KTHISKLEQELERLRGQIKKSPEEYQELTTEGYKSL------MDDEENVSSLLRKYLTPELLE-E 127
            :...::|          :.|..|..:||  .|.|||      .||.:.           |.|| |
plant    72 QIKYNEL----------LAKHQETLREL--NGVKSLHSRNSSKDDADR-----------ETLEAE 113

  Fly   128 YMLVTTP 134
            :..:.||
plant   114 HTTLVTP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4546NP_650501.1 arginine_kinase_like 89..450 CDD:153079 16/53 (30%)
AT2G14045NP_001324165.1 ZIP_TSC22D-like 43..84 CDD:424092 6/52 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3133
orthoMCL 1 0.900 - - OOG6_103096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.