DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4546 and zgc:172076

DIOPT Version :9

Sequence 1:NP_650501.1 Gene:CG4546 / 41922 FlyBaseID:FBgn0038373 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001107070.1 Gene:zgc:172076 / 563955 ZFINID:ZDB-GENE-080204-38 Length:317 Species:Danio rerio


Alignment Length:304 Identity:81/304 - (26%)
Similarity:144/304 - (47%) Gaps:19/304 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VGIFAADADSYDVFNKLFDPIIKDYHGQMDNENDVLQKDPDFGNVDEIENLDPERKYILSARIRL 220
            ||..|.||.||.:|...||.||:.|||.....:.|.:.|.::.|:...::.||  .|:....:.:
Zfish    18 VGCLAGDAQSYILFCDFFDRIIESYHGYKVTSDAVHESDFNYDNLKGGDDFDP--AYVSGCEVTV 80

  Fly   221 ARNIEGLPFFPKLTEKQFIEVEEKVRSATETMDGELIGSYLTMADIDAETQAEMVKRHILFQRGD 285
            :|::|...|....:..:...:.....:|.|.:..:|.|...::.::..|::    .|.::.:...
Zfish    81 SRSVEDFSFPTHCSRGERRRLLTLANTALEQLGEDLPGKLYSIDELSHESE----DRKVVMEFPP 141

  Fly   286 EKLTTAGCYRFWPTGRGVYHNPAETFLIWVNRQDHVHIMSMAQCGDLGDVYNRLVNGLTELEKTL 350
            ..|...|..|.||..|.::.:...:..:|||.:||:.::|......|.:.:..:...:.:||...
Zfish   142 ASLIKIGVARDWPDARALWLSKDGSLAVWVNMEDHLKLVSYRSDASLQEAFKTICINVQKLETLY 206

  Fly   351 AFARH-----PRYGNLTACPTNLGTTLRASVHIRLPLLSKDPDRLLALAEEQQLQVRGTDGGELS 410
            ...||     ...|.:.:.|..:||.|:|||.:.|..|:|: .||..:.:..:||:.       :
Zfish   207 KKLRHTFIWKTHLGWVVSSPAEVGTGLKASVSVNLLNLAKN-KRLDDILDRLRLQME-------T 263

  Fly   411 TVEDGVMDISNKRKLGFTEFELVKTLQDGVVTLINAEEELEISG 454
            |.:.||..|||.:.:|.||..|.:.:.|||..||..|:.||.:|
Zfish   264 TSDPGVYKISNLQTIGVTEVGLTQLVVDGVKLLIRMEKRLENNG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4546NP_650501.1 arginine_kinase_like 89..450 CDD:153079 78/298 (26%)
zgc:172076NP_001107070.1 phosphagen_kinases 3..309 CDD:295496 81/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.