DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4546 and Mycbp

DIOPT Version :9

Sequence 1:NP_650501.1 Gene:CG4546 / 41922 FlyBaseID:FBgn0038373 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_062634.2 Gene:Mycbp / 56309 MGIID:1891750 Length:103 Species:Mus musculus


Alignment Length:96 Identity:30/96 - (31%)
Similarity:59/96 - (61%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ESKRVQYRKYLERAGVIDALSKALIKLYEEQNKPEDAIRFVRKFMCESCPDDAQYDVMKNDLEEA 69
            :|||.|:|:|||::||:|.|:|.|:.||||..||..|:.|::..:..:.|::.:.::::.:|.|.
Mouse     8 DSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGAATPENPEIELLRLELAEM 72

  Fly    70 KTHISKLEQELERLRGQIKKSPEEYQELTTE 100
            |.......:|.::|:.::.:.....:|...|
Mouse    73 KEKYEATVEENKKLKAKLVQYEPPQEEKRAE 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4546NP_650501.1 arginine_kinase_like 89..450 CDD:153079 2/12 (17%)
MycbpNP_062634.2 ZIP_MycBP-like 42..94 CDD:409277 8/51 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9863
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7176
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.