DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4546 and CKM

DIOPT Version :9

Sequence 1:NP_650501.1 Gene:CG4546 / 41922 FlyBaseID:FBgn0038373 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001815.2 Gene:CKM / 1158 HGNCID:1994 Length:381 Species:Homo sapiens


Alignment Length:379 Identity:128/379 - (33%)
Similarity:199/379 - (52%) Gaps:34/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KSPEEYQELTTEGYKSLMDDEENVSSLLRKYLTPELLEEYMLVTTPA--PVDAYLYDCAVSGFEH 151
            |..|||.:|:..            ::.:.|.||.||.::.....||:  .||    |...:|.::
Human    15 KPEEEYPDLSKH------------NNHMAKVLTLELYKKLRDKETPSGFTVD----DVIQTGVDN 63

  Fly   152 HDAP----VGIFAADADSYDVFNKLFDPIIKDYHGQMDNENDVLQKDPDFGNVDEIENLDPERKY 212
            ...|    ||..|.|.:||:||.:||||||.|.||.. ...|..:.|.:..|:...::|||  .|
Human    64 PGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGY-KPTDKHKTDLNHENLKGGDDLDP--NY 125

  Fly   213 ILSARIRLARNIEGLPFFPKLTEKQFIEVEEKVRSATETMDGELIGSYLTMADIDAETQAEMVKR 277
            :||:|:|..|:|:|....|..:..:...||:....|..::.||..|.|..:..:..:.|.:::..
Human   126 VLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDD 190

  Fly   278 HILFQRGDEKLTTA-GCYRFWPTGRGVYHNPAETFLIWVNRQDHVHIMSMAQCGDLGDVYNRLVN 341
            |.||.:....|..| |..|.||..||::||..::||:|||.:||:.::||.:.|::.:|:.|...
Human   191 HFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV 255

  Fly   342 GLTELEKTLAFARHP-----RYGNLTACPTNLGTTLRASVHIRLPLLSKDPDRLLALAEEQQLQV 401
            ||.::|:....|.||     ..|.:..||:||||.||..||::|..|||.| :...:....:||.
Human   256 GLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHP-KFEEILTRLRLQK 319

  Fly   402 RGTDGGELSTVEDGVMDISNKRKLGFTEFELVKTLQDGVVTLINAEEELEISGQ 455
            |||.|.:.:.| ..|.|:||..:||.:|.|.|:.:.|||..::..|::|| .||
Human   320 RGTGGVDTAAV-GSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLE-KGQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4546NP_650501.1 arginine_kinase_like 89..450 CDD:153079 124/372 (33%)
CKMNP_001815.2 creatine_kinase_like 16..373 CDD:153076 127/378 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147545
Domainoid 1 1.000 196 1.000 Domainoid score I3115
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2904
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58958
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm8556
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.