DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp45 and Snapc1

DIOPT Version :9

Sequence 1:NP_650499.1 Gene:Pbp45 / 41920 FlyBaseID:FBgn0038371 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001101503.1 Gene:Snapc1 / 314228 RGDID:1304671 Length:390 Species:Rattus norvegicus


Alignment Length:331 Identity:70/331 - (21%)
Similarity:126/331 - (38%) Gaps:73/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DCWELVQRFQRLVNDGENCEFEVFCRCWRELQLQHLFTAQTNHTEVIATTLAALHVAKRLSCSRR 72
            ||..|:.|||.:    ::..||.|...||.::...:|..:..:.:....|..||.:|   .|   
  Rat    29 DCETLLSRFQEM----DSVRFEDFAELWRSMKFATIFCGKMRNLKKNMFTREALALA---WC--- 83

  Fly    73 TTGDVF--PASRAQRIGGFFLLYVIYYKQPTHNFIKIEVSPRTWQELTDYALDLRKDSPERKDTH 135
                .|  |.:...|:|..:|||.:|..|......||.|:.:.|.|:..:..||  .|.:..|. 
  Rat    84 ----YFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVIKFQQDL--ISAQHFDA- 141

  Fly   136 QIAYMLWRLTQEQAFRFTALDYCQGLDNLVDYDRVETVAGAKEQRQSALMQKQQRANGVSLTYEL 200
              |::..:|..::||.|||:            .::.:....|:.:|:.:.||.:..|.       
  Rat   142 --AFVFRKLRLDRAFHFTAM------------PKLLSCRMKKKAQQAEVTQKFKDPND------- 185

  Fly   201 EGLRALDQASQPLCELEAAYNAQKKQLAAGHEHALPPSQIFGHLREVFADIQSVLGARKSTPDEN 265
               |.:...:..:  ||...|.        |:|              :.:::..:.|.|||||..
  Rat   186 ---RVMKLITSDV--LEEMLNV--------HDH--------------YQNMKHAISADKSTPDRA 223

  Fly   266 CTTTSTGNQLEVRQRVRNKAMYGVEEREP------QNQADELEVQLEVNETYQRRMSSATVFQRE 324
            .:.........::..|.....:..|.:.|      ::..::.|...|..|..:|.:|.|.:..:.
  Rat   224 LSLVKEDFFDNIKNIVLEHQDWHKERKNPSLKPKLKDGEEDGEGPSEEPERCERAVSLAKIKAKA 288

  Fly   325 LPADVQ 330
            ..|..|
  Rat   289 FSAVAQ 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp45NP_650499.1 SNAPc_SNAP43 5..214 CDD:286846 48/207 (23%)
Snapc1NP_001101503.1 SNAPc_SNAP43 26..210 CDD:286846 53/245 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354596
Domainoid 1 1.000 48 1.000 Domainoid score I11640
eggNOG 1 0.900 - - E1_KOG4746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269640at2759
OrthoFinder 1 1.000 - - FOG0006114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107544
Panther 1 1.100 - - LDO PTHR15131
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.