DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MDK and miple2

DIOPT Version :9

Sequence 1:NP_001012333.1 Gene:MDK / 4192 HGNCID:6972 Length:143 Species:Homo sapiens
Sequence 2:NP_001261198.1 Gene:miple2 / 44787 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster


Alignment Length:117 Identity:31/117 - (26%)
Similarity:42/117 - (35%) Gaps:34/117 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    23 KKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYK 87
            |..||.::|| ||:...       ..|:..| |.|:|...|             ..|.|:.|:|.
  Fly   120 KNTDKQQRGG-GSKQQR-------GHSQHHG-GNRKGPKAA-------------TPENGSTCRYA 162

Human    88 FENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKG 139
            ...|..||..|..:.|..:|:|...|            |.|....:.|.|||
  Fly   163 KSAWSNCDHKTNMRSRVLSLRKGEQN------------CLPTRTIQKKCKKG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MDKNP_001012333.1 PTN 37..116 CDD:128490 18/78 (23%)
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 14/56 (25%)
PTN_MK_C 205..255 CDD:279437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.