DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-E and T07D4.5

DIOPT Version :9

Sequence 1:NP_476741.1 Gene:spn-E / 41919 FlyBaseID:FBgn0003483 Length:1434 Species:Drosophila melanogaster
Sequence 2:NP_001122634.1 Gene:T07D4.5 / 6418633 WormBaseID:WBGene00045407 Length:142 Species:Caenorhabditis elegans


Alignment Length:105 Identity:24/105 - (22%)
Similarity:38/105 - (36%) Gaps:33/105 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 NHRRKHSIEKFYRDQLGSIIWNEEDVGHQQVPEINKHGYRAAVKIIVIIDNMERKAAIQSRQSYD 360
            |.:..|..:|..||:...||:....:.|             |.:..|.:||..:|....||:..:
 Worm    13 NAKTPHDHQKELRDKTSEIIYLSTKLNH-------------AKETCVNLDNERQKFREVSRKIKE 64

  Fly   361 EALRYGAVLIFLPGIYEIDTM-AENLTCMLE----NDPNI 395
            :               :||.: ..|.||.|:    |..||
 Worm    65 K---------------DIDPVWIYNGTCFLQTSQANSLNI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ENP_476741.1 HrpA 113..>697 CDD:224557 24/105 (23%)
TUDOR 892..1016 CDD:395449
T07D4.5NP_001122634.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.