powered by:
Protein Alignment spn-E and zcchc17
DIOPT Version :9
Sequence 1: | NP_476741.1 |
Gene: | spn-E / 41919 |
FlyBaseID: | FBgn0003483 |
Length: | 1434 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956838.2 |
Gene: | zcchc17 / 393516 |
ZFINID: | ZDB-GENE-040325-2 |
Length: | 235 |
Species: | Danio rerio |
Alignment Length: | 54 |
Identity: | 17/54 - (31%) |
Similarity: | 22/54 - (40%) |
Gaps: | 17/54 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 821 YVPVSG-RVQSEVYKAVMMRQNRVERPIHIMNPSAFMSYVQQRGIGDVIEGRWI 873
:|.:.| |.|..|:|: .|...|||.|..|: ||.|..||
Zfish 35 FVKIPGYRKQGLVHKS-EMSACRVENPAEIV---------------DVGEQVWI 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
spn-E | NP_476741.1 |
HrpA |
113..>697 |
CDD:224557 |
|
TUDOR |
892..1016 |
CDD:395449 |
|
zcchc17 | NP_956838.2 |
S1_pNO40 |
16..89 |
CDD:240191 |
17/54 (31%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1643 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.