DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3A and ARPC3

DIOPT Version :10

Sequence 1:NP_650498.3 Gene:Arpc3A / 41917 FlyBaseID:FBgn0038369 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_564757.1 Gene:ARPC3 / 842338 AraportID:AT1G60430 Length:174 Species:Arabidopsis thaliana


Alignment Length:169 Identity:69/169 - (40%)
Similarity:107/169 - (63%) Gaps:6/169 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YHSQIKE---VRQQVGNMAILPLRTQVRGPAP-SANIESDIIDESLYYFKANVFFRTYEIKSDVD 64
            |||...:   |.:..| ..:|||::.::|||| |...::||:||::.:|:|||||..::|||..|
plant     3 YHSSFVDEEGVTKACG-CPLLPLKSHIKGPAPVSEQDKTDIVDEAITFFRANVFFTNFDIKSPAD 66

  Fly    65 RVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAISKFDIPGDAGFPLNAVYAKPQTAQDADLMR 129
            ::|||:|.||...||:|....:.|.|.:.:.:|.:....:||:.|||...:::.||:..:|:|.|
plant    67 KLLIYLTFYINVALKRLEGCRTLAVGTKAIINLGLEDIPVPGETGFPFPGLFSLPQSQDEAELFR 131

  Fly   130 QYLLQLRHETGNRVLEKVFNTEDGKPNKWWTCFAKKKFM 168
            .||.|:|.||..|:|...:.. :|.|||||..|||:|||
plant   132 NYLKQVREETSGRLLSVAYRA-NGTPNKWWLAFAKRKFM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3ANP_650498.3 P21-Arc 1..172 CDD:461152 69/169 (41%)
ARPC3NP_564757.1 P21-Arc 2..170 CDD:461152 69/169 (41%)

Return to query results.
Submit another query.