DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3A and ARPC3

DIOPT Version :9

Sequence 1:NP_650498.3 Gene:Arpc3A / 41917 FlyBaseID:FBgn0038369 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001265485.1 Gene:ARPC3 / 10094 HGNCID:706 Length:178 Species:Homo sapiens


Alignment Length:178 Identity:106/178 - (59%)
Similarity:144/178 - (80%) Gaps:1/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAYHSQIKEV-RQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKANVFFRTYEIKSDVD 64
            ||||||.:.:. .:.:||||:||:|:|.:||||....::||:||::|||||||||:.||||::.|
Human     1 MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEAD 65

  Fly    65 RVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAISKFDIPGDAGFPLNAVYAKPQTAQDADLMR 129
            |.|||:||||:||||||.:..||:||:::||:|.|:.|.|||:.||||||:||||...|:.::||
Human    66 RTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMR 130

  Fly   130 QYLLQLRHETGNRVLEKVFNTEDGKPNKWWTCFAKKKFMEKSLAGPGQ 177
            .||.|||.|||.|:.||||:.::.||:||||||.|::||.|||:||||
Human   131 AYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3ANP_650498.3 P21-Arc 1..172 CDD:397948 100/171 (58%)
ARPC3NP_001265485.1 P21-Arc 1..173 CDD:397948 100/171 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160523
Domainoid 1 1.000 229 1.000 Domainoid score I2475
eggNOG 1 0.900 - - E1_KOG3155
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4178
Inparanoid 1 1.050 238 1.000 Inparanoid score I3372
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54322
OrthoDB 1 1.010 - - D1451115at2759
OrthoFinder 1 1.000 - - FOG0004013
OrthoInspector 1 1.000 - - otm40583
orthoMCL 1 0.900 - - OOG6_102731
Panther 1 1.100 - - LDO PTHR12391
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2769
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.