DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc3A and arpc3

DIOPT Version :9

Sequence 1:NP_650498.3 Gene:Arpc3A / 41917 FlyBaseID:FBgn0038369 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001107138.1 Gene:arpc3 / 100038232 XenbaseID:XB-GENE-494115 Length:178 Species:Xenopus tropicalis


Alignment Length:178 Identity:105/178 - (58%)
Similarity:140/178 - (78%) Gaps:1/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAYHSQIKEV-RQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKANVFFRTYEIKSDVD 64
            ||||||.:.|. .:.:||||:||:|:|.:||||....::|||||::|||||||||:.||||::.|
 Frog     1 MPAYHSMLMESDTKLIGNMAMLPIRSQFKGPAPRETKDTDIIDEAIYYFKANVFFKNYEIKNEAD 65

  Fly    65 RVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAISKFDIPGDAGFPLNAVYAKPQTAQDADLMR 129
            |.|||:||||:||||||.:..||.||:::||:|.|:.|.|||:.||||||:|.||...|:.::||
 Frog    66 RTLIYITLYISECLKKLQKCNSKGQGEKEMYTLGITNFPIPGEPGFPLNAMYVKPSNKQEDEVMR 130

  Fly   130 QYLLQLRHETGNRVLEKVFNTEDGKPNKWWTCFAKKKFMEKSLAGPGQ 177
            .||.|||.|||.|:.:|||:.:..||:|||.||.|::||.|||:||||
 Frog   131 AYLQQLRQETGLRLCDKVFDPQTDKPSKWWICFVKRQFMNKSLSGPGQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc3ANP_650498.3 P21-Arc 1..172 CDD:397948 99/171 (58%)
arpc3NP_001107138.1 P21-Arc 1..173 CDD:367792 99/171 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 219 1.000 Domainoid score I2591
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4178
Inparanoid 1 1.050 228 1.000 Inparanoid score I3378
OMA 1 1.010 - - QHG54322
OrthoDB 1 1.010 - - D1451115at2759
OrthoFinder 1 1.000 - - FOG0004013
OrthoInspector 1 1.000 - - otm47758
Panther 1 1.100 - - LDO PTHR12391
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2769
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.