DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4576 and CG30467

DIOPT Version :9

Sequence 1:NP_650495.1 Gene:CG4576 / 41914 FlyBaseID:FBgn0038366 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:297 Identity:63/297 - (21%)
Similarity:97/297 - (32%) Gaps:79/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KSELEALQAGLLSENAKVNVYLDLFSMEANNRQRHQRLTNACLNWRLQRRGFGVLAKSVVEYCDE 174
            |.|.|...:| |:..||.|   |:.|.|.:|.:......:|..:    ............|..:|
  Fly     3 KEEAEPSASG-LAVAAKQN---DVPSAENSNHKESDAYASASAS----ASSASTTPPPAQEDAEE 59

  Fly   175 AG--HQVEDDAWNLTFYGILGTLLVLACLGSLVDLHLKRSRHDKMLKERDHYKTPPKSTAQQV-- 235
            |.  .::..||...|.|.....|..:..:|.|    |:.|..|:.| |.|..|....|.:.:|  
  Fly    60 AELLERMRGDAVGNTMYSSRFILKTVMRVGEL----LRHSTLDQQL-EDDLCKVWDMSVSPEVVT 119

  Fly   236 -----------LLTFSVARNWYRLNQEPSGKIGRELRFLDCFKFFA------------------- 270
                       :.|........||.:...|.:|.....::|.:..|                   
  Fly   120 LLLENGAIDPIMYTLVAGCEDVRLYEILIGLLGNMCAQVECAEILACDRYTLETLFKMTYCMDTA 184

  Fly   271 -------MFMVIFAH---------TNWVIYESAISN-PQDPERLLHTAAGTLLVSGSLITVTFFV 318
                   :|..|.||         .||.|..:|..| .|:..|:|.     |.||..|:...   
  Fly   185 MLIQLMRLFQYIMAHVLSGKEKFAVNWYICFAAFENSAQNLGRILQ-----LSVSDELLVAA--- 241

  Fly   319 ISGLLLTINWLAVSRSL---ESKKDTWSFGQYALLFV 352
                |...|.:..|.:|   |:...|.:...:|.:|:
  Fly   242 ----LKATNAVLASCALVEEENANSTLNLKPFAEVFL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4576NP_650495.1 Acyl_transf_3 260..657 CDD:280013 26/132 (20%)
OafA 303..668 CDD:224748 12/53 (23%)
CG30467NP_611044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.