DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fgg

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001304034.1 Gene:Fgg / 99571 MGIID:95526 Length:443 Species:Mus musculus


Alignment Length:376 Identity:106/376 - (28%)
Similarity:156/376 - (41%) Gaps:81/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LRGLEINLHRVLSKVVLLADAV--VQV---------PGRYSS-------------KEDPLAVLSE 93
            ||.||..|.|..::.....:.:  :||         ||...|             |.:.|.:..|
Mouse    65 LRTLEDILFRAENRTTEAKELIKAIQVYYNPDQPPKPGMIDSATQKSKKMVEEIVKYEALLLTHE 129

  Fly    94 -RLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFYQPAKSDCHE 157
             .:..|.|..|...:..|||.:........||||.            ||  .|..:.....||.|
Mouse   130 TSIRYLQEIYNSNNQKITNLKQKVAQLEAQCQEPC------------KD--SVQIHDTTGKDCQE 180

  Fly   158 L-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHENFNRSWDEYR 220
            : ::|.:..|:| |:.|.:.:.|   :..||.....|..|||:|.| .||.|    |.::|.:|:
Mouse   181 IANKGAKESGLY-FIRPLKAKQQ---FLVYCEIDGSGNGWTVLQKRIDGSLD----FKKNWIQYK 237

  Fly   221 AGFGNLS----RDFWFGNEFAHKILYRD--DHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLS 279
            .|||:||    .:||.|||..|.|..:.  .:.|||:|::.......|:|.:|.:..||..|:|:
Mouse   238 EGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNGRTSTADYAMFRVGPESDKYRLT 302

  Fly   280 VAGEFRGSLPDALE--------------QHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRC 330
            .|....|...||.:              .||.|.|||:|   |.....:..|.|..|.|||.::|
Mouse   303 YAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWD---NDNDKFEGNCAEQDGSGWWMNKC 364

  Fly   331 TQCNLNG---EHGVHQRAS------PAIIWMNWRTGTDKPKSSRMMIRPVN 372
            ...:|||   :.|.:.::|      ..|||..|::.....|.:.|.|.|.|
Mouse   365 HAGHLNGVYHQGGTYSKSSTTNGFDDGIIWATWKSRWYSMKETTMKIIPFN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 77/251 (31%)
FggNP_001304034.1 Fib_alpha 30..171 CDD:285864 27/119 (23%)
FReD 174..413 CDD:294064 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.