DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Angpt2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_604449.1 Gene:Angpt2 / 89805 RGDID:621861 Length:496 Species:Rattus norvegicus


Alignment Length:379 Identity:101/379 - (26%)
Similarity:163/379 - (43%) Gaps:84/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELVLIRKTLAAQALKLRGL----EINLHRVLSKVVLLADAVVQVPGRYS-------SKEDPLAVL 91
            ||.|::.:::...|:.:.|    |||  ::..|...|...|:.:..::|       .::|.|.||
  Rat   157 ELQLLQHSISTNKLEKQILDQTSEIN--KLQDKNSFLEKKVLDMEDKHSVQLQSMKEQKDQLQVL 219

  Fly    92 SERLNLLLERLNQEERIST-------------NLLELKEWSTKVCQEP--SPSQTLPKELTEEKD 141
            ..:.:.:::.|  |:::.|             :|:|.......:...|  ..|..:||       
  Rat   220 VSKQSSVIDEL--EKKLVTATVNNSVLQKQQHDLMETVNSLLTMMSSPDYKSSVAVPK------- 275

  Fly   142 EPKVDFYQPAKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GG 204
            |.|..|     .||.|: ..|:...|:|....|...|.    .:.||.....|..|||||.| .|
  Rat   276 EEKTTF-----RDCAEIFKSGLTTSGIYTLTFPNSTEE----VKAYCDMDMGGGGWTVIQHREDG 331

  Fly   205 SFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDW------AE 263
            |.|    |.|:|.||:.|||:...::|.||||..::.....:.|:|:|:      ||      :.
  Rat   332 SVD----FQRTWKEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLK------DWEGSEAHSL 386

  Fly   264 YPLFWLDSESYNYQLSVAG--EFRGSLPDALEQHNRMDFSTYDRRRNHAKSADS-----TCGEDY 321
            |..|:|..|..||::.:.|  ...|.:....:..:  ||||        |.:|:     .|.:..
  Rat   387 YEHFYLSGEESNYRIHLTGLTGTAGKISSISQPGS--DFST--------KDSDNDKCICKCSQML 441

  Fly   322 GGGWWFDRCTQCNLNGEHGVHQRAS---PAIIWMNWRTGTDKPKSSRMMIRPVN 372
            .||||||.|...||||::...::.:   ..|.|..|:......|::.|||||.:
  Rat   442 TGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 72/238 (30%)
Angpt2NP_604449.1 Mplasa_alph_rch <78..>232 CDD:275316 17/78 (22%)
FBG 280..494 CDD:214548 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.