DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and FCN3

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:226 Identity:79/226 - (34%)
Similarity:113/226 - (50%) Gaps:18/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QPAKSDCHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHEN 211
            |....:|.| |.:|..:.|.|...:||...:     ..:|...|:|..|.|.|.| .||.|    
Human    87 QEGPRNCRELLSQGATLSGWYHLCLPEGRAL-----PVFCDMDTEGGGWLVFQRRQDGSVD---- 142

  Fly   212 FNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNY 276
            |.|||..|||||||...:||.|||..|::..:.:.|||:||::......:|.|..|.|..|..:|
Human   143 FFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHY 207

  Fly   277 QLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEHGV 341
            ||::.....|:..|:|..|:...|:|||...:   |::|.|.....|.||:..|.:.||||.:.|
Human   208 QLALGKFSEGTAGDSLSLHSGRPFTTYDADHD---SSNSNCAVIVHGAWWYASCYRSNLNGRYAV 269

  Fly   342 HQRASP--AIIWMNWRTGTDKP-KSSRMMIR 369
            .:.|:.  .|.|.:.| |...| :..|||:|
Human   270 SEAAAHKYGIDWASGR-GVGHPYRRVRMMLR 299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 78/225 (35%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81
FReD 90..299 CDD:238040 77/221 (35%)