DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fcna

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_112638.2 Gene:Fcna / 83517 RGDID:621221 Length:335 Species:Rattus norvegicus


Alignment Length:214 Identity:70/214 - (32%)
Similarity:106/214 - (49%) Gaps:12/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDEYRAG 222
            |..|:.:.|.|...:|:...:     ...|....||..|||.|.|   .|...||.|.||.|:.|
  Rat   130 LTRGIFLTGWYTIYLPDCRPL-----TVLCDMDVDGGGWTVFQRR---VDGSINFYRDWDSYKRG 186

  Fly   223 FGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGS 287
            ||||..:||.||::.|.:....:.|||::|:|......:|:|..|.:..|...|:|::.....|:
  Rat   187 FGNLGTEFWLGNDYLHLLTANGNQELRVDLREFQGQTSFAKYSSFQVSGEQEKYKLTLGQFLEGT 251

  Fly   288 LPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH--GVHQRASPAII 350
            ..|:|.:||.|.|||:|  :::..:....|...:.|.||:..|.|.||||.:  |.|:..:..|.
  Rat   252 AGDSLTKHNNMAFSTHD--QDNDTNGGKNCAALFHGAWWYHDCHQSNLNGRYLPGSHESYADGIN 314

  Fly   351 WMNWRTGTDKPKSSRMMIR 369
            |::.|......|.:.|.||
  Rat   315 WLSGRGHRYSYKVAEMKIR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 70/214 (33%)
FcnaNP_112638.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..114
Collagen <67..108 CDD:396114
FReD 123..333 CDD:238040 68/212 (32%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 8/36 (22%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 33/90 (37%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 291..293 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 326..335 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.