DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Angptl1

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_082609.2 Gene:Angptl1 / 72713 MGIID:1919963 Length:490 Species:Mus musculus


Alignment Length:407 Identity:105/407 - (25%)
Similarity:182/407 - (44%) Gaps:86/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DIGFKSLEELVLIRK--------------TLAAQALKLRGLEINLHRVLSKVVLLADAVVQVPGR 80
            |:....:.|:.|:||              .|..:.::.|...:.|.::.:|::.:...::::..|
Mouse   106 DVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATR 170

  Fly    81 YSSKEDPLAVLSERLNLLLERLNQEERISTNLLE---LKEWSTKVCQEPSPSQTL---------- 132
            |...|...|.|::.:|      ||.  ::..:||   |:.:|.   |:|..|..|          
Mouse   171 YRELEVKYASLTDLVN------NQS--VTITVLEEQCLRMFSR---QDPHASPPLVQVVPRHSPN 224

  Fly   133 --------------------PKELTEEKDEPKVDFYQPAK------------SDCHELDE-GVRV 164
                                |:::....|.|......|.|            .||.:..| |...
Mouse   225 SHQYTPGLLGGNEIQRDPGYPRDVMPPPDLPTAPTKSPFKIPAVTFINEGPFKDCQQAKEAGHSA 289

  Fly   165 DGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRD 229
            .|:| .:.||.:   ..|.:.:|..:.|...|||||.|   .|...||.|:|:.|:.||||:..:
Mouse   290 SGIY-MIKPENS---NGLMQLWCENSLDPGGWTVIQKR---TDGSVNFFRNWENYKKGFGNIDGE 347

  Fly   230 FWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQ 294
            :|.|.:..:|:..:|:::|.|||::..|...:|||..|.|:.||..|:|.: |.::|:..|::..
Mouse   348 YWLGLDNIYKLSNQDNYKLMIELEDWSEKKVYAEYSSFRLEPESDYYRLRL-GTYQGNAGDSMMW 411

  Fly   295 HNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNG--EHGVHQRA--SPAIIWMNWR 355
            ||...|:|.||.::   :....|...:.||||::.|...||||  ..|.|.|:  ...|.|..:|
Mouse   412 HNGKQFTTLDRDKD---TYTGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYR 473

  Fly   356 TGTDKPKSSRMMIRPVN 372
            .|:...::.:|||:|::
Mouse   474 GGSYSLRAVQMMIKPID 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 76/237 (32%)
Angptl1NP_082609.2 RILP-like 91..207 CDD:304877 21/111 (19%)
FReD 274..489 CDD:238040 74/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.