DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and TNXB

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001352205.1 Gene:TNXB / 7148 HGNCID:11976 Length:4244 Species:Homo sapiens


Alignment Length:231 Identity:78/231 - (33%)
Similarity:111/231 - (48%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PAKSDC-HELDEGVRVDGVYR----FLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPH 209
            |...|| .|:..|.   |..|    ||...|   :|.| ..:|...|||..|.|.|.|   .|..
Human  4025 PFPRDCGEEMQNGA---GASRTSTIFLNGNR---ERPL-NVFCDMETDGGGWLVFQRR---MDGQ 4079

  Fly   210 ENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESY 274
            .:|.|.|::|..||||:|.:||.|||..|.:....|:.:|::|: ||:...:|:|..|.:||.:.
Human  4080 TDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLR-AGDEAVFAQYDSFHVDSAAE 4143

  Fly   275 NYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH 339
            .|:|.:.| :.|:..|::..|:...||..||..|   |...:|...|.|.||:..|...||||.:
Human  4144 YYRLHLEG-YHGTAGDSMSYHSGSVFSARDRDPN---SLLISCAVSYRGAWWYRNCHYANLNGLY 4204

  Fly   340 GV---HQRASPAIIWMNWRTGTDKPKSSRMMIRPVN 372
            |.   ||..|    |.:|:........:.|.:||.|
Human  4205 GSTVDHQGVS----WYHWKGFEFSVPFTEMKLRPRN 4236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 76/228 (33%)
TNXBNP_001352205.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..189
EGF_2 189..213 CDD:285248
EGF_2 216..244 CDD:285248
VSP <254..669 CDD:333463
EGF_2 621..647 CDD:285248
fn3 762..831 CDD:306538
fn3 843..919 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 926..956
fn3 1061..1141 CDD:306538
FN3 1156..1238 CDD:238020
fn3 1265..1342 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1340..1372
fn3 1376..1446 CDD:306538
fn3 1475..1555 CDD:306538
fn3 1578..1643 CDD:306538
Cell attachment site. /evidence=ECO:0000255 1666..1668
fn3 1672..1739 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1752..1777
FN3 1773..1862 CDD:238020
fn3 1885..1955 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1968..1990
fn3 1988..2061 CDD:306538
fn3 2099..2169 CDD:306538
fn3 2198..2268 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2281..2304
fn3 2304..2377 CDD:306538
fn3 2418..2485 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2495..2542
fn3 2526..2596 CDD:306538
fn3 2629..2709 CDD:306538
fn3 2743..2810 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2824..2847
fn3 2845..2925 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2933..2969
fn3 2959..3026 CDD:306538
fn3 3061..3134 CDD:306538
fn3 3170..3240 CDD:306538
fn3 3263..3328 CDD:306538
fn3 3354..3436 CDD:306538
fn3 3453..3515 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3536..3559
fn3 3562..3637 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3636..3662
fn3 3656..3738 CDD:306538
fn3 3758..3836 CDD:306538
FN3 3845..3931 CDD:238020
fn3 3935..4012 CDD:306538
Fibrinogen_C 4026..4235 CDD:278572 75/227 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.