DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and TNR

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_003276.3 Gene:TNR / 7143 HGNCID:11953 Length:1358 Species:Homo sapiens


Alignment Length:225 Identity:75/225 - (33%)
Similarity:110/225 - (48%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PAKSDC-HELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHENF 212
            |...|| ..|..|..:.|||...:  ..|:.:.| :.||...|||..|.|.|.| .|..|    |
Human  1133 PHPQDCAQHLMNGDTLSGVYPIFL--NGELSQKL-QVYCDMTTDGGGWIVFQRRQNGQTD----F 1190

  Fly   213 NRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQ 277
            .|.|.:||.||||:..:||.|.:..|:|..:..:|||::::: |:...:|.|..|.::.....|:
Human  1191 FRKWADYRVGFGNVEDEFWLGLDNIHRITSQGRYELRVDMRD-GQEAAFASYDRFSVEDSRNLYK 1254

  Fly   278 LSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEHGVH 342
            |.: |.:.|:..|:|..|....|||.||..:   .|.:.|...|.|.||:..|.:.||||::| .
Human  1255 LRI-GSYNGTAGDSLSYHQGRPFSTEDRDND---VAVTNCAMSYKGAWWYKNCHRTNLNGKYG-E 1314

  Fly   343 QRASPAIIWMNWRTGTDKPKSSRMMIRPVN 372
            .|.|..|.|.:|:..........|.:||.|
Human  1315 SRHSQGINWYHWKGHEFSIPFVEMKMRPYN 1344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 73/222 (33%)
TNRNP_003276.3 EGF_2 <208..230 CDD:285248
EGF_2 267..292 CDD:285248
EGF_2 299..323 CDD:285248
fn3 328..398 CDD:278470
fn3 416..496 CDD:278470
fn3 505..583 CDD:278470
FN3 595..679 CDD:238020
fn3 687..766 CDD:278470
fn3 776..855 CDD:278470
fn3 865..944 CDD:278470
fn3 954..1026 CDD:278470
FN3 1042..1127 CDD:238020
FReD 1133..1342 CDD:238040 72/221 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.