DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Angptl7

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001034643.1 Gene:Angptl7 / 654812 MGIID:3605801 Length:337 Species:Mus musculus


Alignment Length:336 Identity:99/336 - (29%)
Similarity:157/336 - (46%) Gaps:38/336 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RKTLAAQALKLRGLEINLHRVLSKVVLLADAVVQVPGRYSSKE--DPLAVLSERLNLLLERLNQE 105
            |||    .||..|....:..:.::|..|:..:    |..|.|:  |.::|:.:.:.|.....:.|
Mouse    27 RKT----QLKAAGCCEEMRELKAQVANLSSLL----GELSRKQESDWVSVVMQVMELESSSKHME 83

  Fly   106 ERISTNLLELKEWSTKV-CQEPSPSQTLPKELTEEKDEPKVDFYQPAKSDCHEL-DEGVRVDGVY 168
            .|:||...:..|.:.:: ..:...:||:.:...:            |..||..| .:..|:.|||
Mouse    84 SRLSTAESKYSEMNNQIDIMQLQAAQTVTQTSAD------------AIYDCSSLYQKNYRISGVY 136

  Fly   169 RFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFG 233
            : |.|:......:| |.:|...|.|..||:||.|....   .:|.:.|.:|:.|||::..|||.|
Mouse   137 K-LPPDEFLGSPEL-EVFCDMETSGGGWTIIQRRKSGL---VSFYQDWRQYKQGFGSIRGDFWLG 196

  Fly   234 NEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSL-PDALEQHNR 297
            ||..|: |.|....||:||::......:|||..|.|.:|..:|:|.: |.:.|:: .|||..||.
Mouse   197 NEHIHR-LTRQPSRLRVELEDWEGNARYAEYSYFALGNELNSYRLFL-GNYSGNVGKDALLYHNN 259

  Fly   298 MDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH---GVHQRASPAIIWMNWRTGTD 359
            ..|||.|:..::..   ..|.:...||:|::.||..||||.:   |.|::....|.|..|.....
Mouse   260 TVFSTKDKDNDNCL---DKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHRKHMDGISWYGWHGANY 321

  Fly   360 KPKSSRMMIRP 370
            ..|...|.|||
Mouse   322 SLKRVEMKIRP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 78/226 (35%)
Angptl7NP_001034643.1 FReD 120..332 CDD:238040 75/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.