DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and TNN

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_016857537.1 Gene:TNN / 63923 HGNCID:22942 Length:1317 Species:Homo sapiens


Alignment Length:225 Identity:72/225 - (32%)
Similarity:106/225 - (47%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PAKSDCHELDEGVR-VDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRG-GSFDPHENF 212
            |..|||.::.:... ..|:|...:  ..:..|.| :.||...|||..|.|.|.|. |..|    |
Human  1083 PHPSDCSQVQQNSNAASGLYTIYL--HGDASRPL-QVYCDMETDGGGWIVFQRRNTGQLD----F 1140

  Fly   213 NRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDD--HELRIELQEAGEPLDWAEYPLFWLDSESYN 275
            .:.|..|..|||:..::||.|.:..|.:.....  :|:|::||.|.|.. :|.|..|.:.|....
Human  1141 FKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTPARYEVRVDLQTANESA-YAIYDFFQVASSKER 1204

  Fly   276 YQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEHG 340
            |:|:| |::||:..|||..||...|:|:||..:.|.   |.|...:.||||:..|...|.||.:|
Human  1205 YKLTV-GKYRGTAGDALTYHNGWKFTTFDRDNDIAL---SNCALTHHGGWWYKNCHLANPNGRYG 1265

  Fly   341 VHQRASPAIIWMNWRTGTDKPKSSRMMIRP 370
             ..:.|..:.|..|:..........:.|||
Human  1266 -ETKHSEGVNWEPWKGHEFSIPYVELKIRP 1294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 72/225 (32%)
TNNXP_016857537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.