DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Angptl4

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_065606.2 Gene:Angptl4 / 57875 MGIID:1888999 Length:410 Species:Mus musculus


Alignment Length:395 Identity:110/395 - (27%)
Similarity:157/395 - (39%) Gaps:89/395 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSTGSLNR----IGNS-------DIGFKSLEELVLIRKTLAAQALKLRGLEINLHRVLSKVVLLA 71
            |..|:|.|    .||:       |..||..|:.|...:|...    |:.|:..|....||:..|.
Mouse    64 GQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPET----LQSLQTQLKAQNSKIQQLF 124

  Fly    72 DAVVQVPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKEL 136
            ..|.| ..||.||:          ||.::.|..:    .:||........| .:.|..:.|||..
Mouse   125 QKVAQ-QQRYLSKQ----------NLRIQNLQSQ----IDLLAPTHLDNGV-DKTSRGKRLPKMT 173

  Fly   137 TEEKDEPKVDFYQPAKSDCHEL-DEGVRVDGVYR--------FLVPERNEVQRDLYERYCAFATD 192
            ......|..........||.|| .||.|..|:::        |||             .|...:|
Mouse   174 QLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLV-------------NCEMTSD 225

  Fly   193 GPAWTVIQSR-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAG 256
            | .|||||.| .||.|    ||:||:.|:.|||:...:||.|.|..|.|......:|.::||   
Mouse   226 G-GWTVIQRRLNGSVD----FNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQ--- 282

  Fly   257 EPLDW------AEYPLFWLDSESYNYQLSVAGEFRGSL------PDALEQHNRMDFSTYDRRRNH 309
               ||      .::|:. |..|...|.|.:.......|      |:.|.    :.|||:|  ::|
Mouse   283 ---DWDGNAKLLQFPIH-LGGEDTAYSLQLTEPTANELGATNVSPNGLS----LPFSTWD--QDH 337

  Fly   310 AKSADSTCGEDYGGGWWFDRCTQCNLNGE--HGV---HQRASPAIIWMNWRTGTDKPKSSRMMIR 369
            ....|..|.:...|||||..|:..||||:  |.:   .|.....|.|..|:......:::.::|:
Mouse   338 DLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQ 402

  Fly   370 PVNPT 374
            |:..|
Mouse   403 PMEAT 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 73/247 (30%)
Angptl4NP_065606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..101 5/21 (24%)
Fib_alpha <104..133 CDD:285864 8/33 (24%)
FReD 187..404 CDD:238040 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.