DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and CG41520

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001104019.1 Gene:CG41520 / 5740294 FlyBaseID:FBgn0087011 Length:745 Species:Drosophila melanogaster


Alignment Length:227 Identity:75/227 - (33%)
Similarity:113/227 - (49%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LDEGVRVDGVYRFLVPERNEVQRDLY---ERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDEY 219
            |:.|::..||:..      :::...|   :.||...|....|||||.|....|..|||||.|.:|
  Fly   521 LNAGMKQSGVFYL------QIRGTTYWFLKVYCDQETTDGGWTVIQRRDDFKDSRENFNRDWADY 579

  Fly   220 RAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEF 284
            :.|||..|:|||.|||..:.:...:::.||:||::......:|:|..|.:.||:..|:|.:.| :
  Fly   580 KNGFGEPSKDFWLGNENIYMLTNNEEYSLRVELEDFEGNKRYAQYSHFKIHSEADYYKLEIDG-Y 643

  Fly   285 RGSLPDALEQ----HNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEHGVHQ-- 343
            .|:..|:|..    .|...||||::..:.   :...|.....||||:..|.: .|||.: :|.  
  Fly   644 EGNAGDSLNDPWYGSNNSPFSTYNKDNDR---SSLNCASMLKGGWWWKSCGR-GLNGLY-LHDPQ 703

  Fly   344 --RASPAIIWMNWRTGTDKPKSSRMMIRPVNP 373
              .|...|:|..||......|.|:|||||..|
  Fly   704 DITARQGIVWFRWRGWDYTLKKSKMMIRPRIP 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 73/223 (33%)
CG41520NP_001104019.1 FReD 516..733 CDD:238040 73/223 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.