DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and fibcd1b

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_005171959.1 Gene:fibcd1b / 567525 ZFINID:ZDB-GENE-070424-245 Length:492 Species:Danio rerio


Alignment Length:374 Identity:108/374 - (28%)
Similarity:169/374 - (45%) Gaps:53/374 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TGSLNRIGNSDIGFKSLEELVLIRKTLAAQALKLRGLEINLHRVLSKVVLLADAVVQVPGRYSSK 84
            |..|:.:.:.|...||::.             :.|.|.:||...::|   |:....|:...|.|.
Zfish   141 TSLLHSLTDHDTDLKSVKG-------------QDRALLVNLAEEVAK---LSAHAGQLKMDYESL 189

  Fly    85 EDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPS-QTLPKELTEEKDEPKVDFY 148
            ....:.|.:.||.|   ..::.|:...|.|.:....||....|.: ..:.||....|...|.|..
Zfish   190 RRGQSNLGQDLNTL---QTEQSRLIQLLSESQINMVKVVNSVSDALNAMQKETGGLKARVKADLQ 251

  Fly   149 Q-PAKS-------------DCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTV 198
            : |.:.             ||.:: ..|.|.||:|. :.|......   ::.||..:|||..|||
Zfish   252 RAPVRGVRLKGCANGSRPRDCSDIYASGQREDGIYS-VFPTHYPAG---FQVYCDMSTDGGGWTV 312

  Fly   199 IQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAE 263
            ||.|.   |...||.|.||.||.|||.::.::|.|.:..|.:..:.::||||:|::......:|:
Zfish   313 IQRRE---DGSVNFFREWDSYREGFGKITGEYWLGLKQIHALSIQGNYELRIDLEDFENSTAFAQ 374

  Fly   264 Y-----PLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGG 323
            |     .||.:|.|...|.|::| ::.|:..|:|.:||.|.|:|.||..:|   :::.|...|.|
Zfish   375 YGVFGVGLFSVDPEDDGYPLTIA-DYTGTAGDSLLKHNGMKFTTKDRDNDH---SENNCASFYHG 435

  Fly   324 GWWFDRCTQCNLNGEH--GVHQRASPAIIWMNWRTGTDKPKSSRMMIRP 370
            .||:..|...||||::  |.|...:..|.|.:|.......|.:.|.|||
Zfish   436 AWWYRNCHTSNLNGQYLRGQHTSYADGIEWSSWTGWQYSLKFTEMKIRP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 79/242 (33%)
fibcd1bXP_005171959.1 FReD 269..484 CDD:238040 76/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.