DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and fgl2a

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001020710.1 Gene:fgl2a / 565637 ZFINID:ZDB-GENE-030131-9506 Length:451 Species:Danio rerio


Alignment Length:343 Identity:103/343 - (30%)
Similarity:165/343 - (48%) Gaps:53/343 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LRGLEINLHRVLSKVVLLADAVVQVPGRYSSKEDPLAVLSERLNLL-LERL-NQEERISTNLLEL 115
            ::.:::.::|:.|.:......:..:.||.           |.|||| |:.: |..:|...|:..:
Zfish   142 VQNMQVKMNRMSSSLKNARAQINSLQGRL-----------EELNLLNLQNVENIVDRKVENITGM 195

  Fly   116 KEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFYQPAKSDCHELDE-GVRVDGVYRFLVPERNEVQ 179
            ....:..|.. .|.|.|  :|....:.|        ..||.::.. |.|::.||:.....||   
Zfish   196 VNKISSTCTS-CPGQQL--QLQHLTNIP--------PRDCSDISMLGQRINKVYQVTPDPRN--- 246

  Fly   180 RDLYERYCAFATDGPAWTVIQSR-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYR 243
             ..:..||...:.|..|||||.| .||.    :|||:|.:|:.|||||:.:||.||:..|.:...
Zfish   247 -GSFAVYCDMESFGGGWTVIQHRINGSV----SFNRTWADYKKGFGNLNSEFWLGNDKIHLLTKA 306

  Fly   244 DDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALE-----QHNRMDFSTY 303
            .|..|||||:::.....:|:|..|::.:|..:|:|||:| :.|:..:||:     .|::..|:|.
Zfish   307 KDMILRIELEDSEGTRGYAKYDQFYVSNEFLHYRLSVSG-YSGTAGNALQFSKHFNHDQKFFTTP 370

  Fly   304 DRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH--GVHQRASPAIIWMNWRTGTDK--P--- 361
            |:..:...|.:  ||..||.|||||.|...||||::  ..::.....|.|..|...|.:  |   
Zfish   371 DKDNDRYPSGN--CGAYYGSGWWFDACMSANLNGKYYKTKYKGKRDGIFWGTWPNATSEYYPTSF 433

  Fly   362 ----KSSRMMIRPVNPTP 375
                |:.:|||||.|..|
Zfish   434 RQAYKNVKMMIRPKNYAP 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 81/238 (34%)
fgl2aNP_001020710.1 FReD 219..447 CDD:238040 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.