DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and si:ch211-203k16.3

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_021324371.1 Gene:si:ch211-203k16.3 / 559151 ZFINID:ZDB-GENE-041014-290 Length:425 Species:Danio rerio


Alignment Length:372 Identity:101/372 - (27%)
Similarity:163/372 - (43%) Gaps:79/372 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EELVLIRKTLAAQALKLRGLEINLHRVLSKVVLL-------------------------ADAVVQ 76
            ::::.:::|::....:||.   :.|||  ||:.|                         |..::.
Zfish    86 QQILALKETVSELQEELRN---HRHRV--KVLELQSEEKNHNSSSIEQRLHELENHYAEASTLLH 145

  Fly    77 VPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELTEEKD 141
            :.|   |....|......|::|:|::.:......|::                :|.|....:|..
Zfish   146 IQG---SLIYDLQAQIHNLSMLVEKVRRNPGCMINIV----------------RTSPLINAQEAL 191

  Fly   142 EPKVDFYQPAKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGS 205
            .|:|...:....||..: ..|||..|:|. :||....:.   .|.||...|||..|||||.|.  
Zfish   192 HPEVQNVRNCPIDCASIYYNGVRRSGIYT-VVPSLGAMP---VEVYCDMDTDGGGWTVIQRRQ-- 250

  Fly   206 FDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLD 270
             |...||:|||.||:.|||:|..::|.|||..|.:..:.|:.|||:|::.......|.|..|.::
Zfish   251 -DGSVNFDRSWKEYKEGFGDLHTEYWLGNEHIHDLTSQGDYMLRIDLEDWSNKHKHALYQSFSVE 314

  Fly   271 SESYNYQLSVAGEFRGSLPDALE-QHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCN 334
            .|:..|:|.|:| |.|::.|:.. .|::..|||.|        ..:.|.|....|||:::|...|
Zfish   315 DENTQYRLHVSG-FSGTVEDSFSWYHDKQGFSTPD--------TGNICAEISHAGWWYNQCFYTN 370

  Fly   335 LNGEH---------GVHQRASPAIIWMNWRTGTDKPKSSR--MMIRP 370
            |||.:         |.:......::|..|: .:|.....|  |||||
Zfish   371 LNGIYYKGGRYSLKGKNSLGPDGVVWFTWK-DSDYYSLRRVSMMIRP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 79/234 (34%)
si:ch211-203k16.3XP_021324371.1 SMC_N 73..>158 CDD:330553 13/79 (16%)
FReD 202..417 CDD:238040 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.