DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and fcn2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_031747902.1 Gene:fcn2 / 548398 XenbaseID:XB-GENE-5789613 Length:312 Species:Xenopus tropicalis


Alignment Length:251 Identity:84/251 - (33%)
Similarity:122/251 - (48%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SPSQTLPKELTEEKDEPKVDFYQPAKSDCHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFA 190
            :|.:::..|..::.|..::|....|| :|.| ||:|..:...|. :.||..:..:.|    |...
 Frog    78 APGESIKGEKGDKGDSGRLDSLYAAK-NCKELLDQGEILTDWYT-IYPENTQPMKVL----CDMH 136

  Fly   191 TDGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEA 255
            |||..|.|.|.|   :|...||||.|:.|:.||||...:||.|||..:::......|||||||:.
 Frog   137 TDGGGWIVFQRR---WDGSVNFNRDWNSYKTGFGNRLNEFWLGNENLYELTSSGTWELRIELQDF 198

  Fly   256 GEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGED 320
            .....:..|..|.|..|:..|:|.:.....|::.::::.|..|.|||.|...:..|     |...
 Frog   199 ENVNYFVIYSSFKLLGEADKYKLLLGNLKEGNIGNSMDVHVNMPFSTLDNDVSPGK-----CVAK 258

  Fly   321 YGGGWWFDRCTQCNLNGEH--GVHQRASPAIIWMNWRTGTD---KPKSSRMMIRPV 371
            |.||||::.|...||||.:  |.|...:..|   ||.:|..   ..|.|.|.||||
 Frog   259 YKGGWWYNDCHHANLNGPYLPGQHSSYADGI---NWASGKGYHYSYKHSEMKIRPV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 78/226 (35%)
fcn2XP_031747902.1 FReD 103..311 CDD:238040 77/224 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.