DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and ANGPT4

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_057069.1 Gene:ANGPT4 / 51378 HGNCID:487 Length:503 Species:Homo sapiens


Alignment Length:389 Identity:106/389 - (27%)
Similarity:172/389 - (44%) Gaps:81/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LIRKTLAAQALKLRGLEINL------------------HRVLSKVVLLADAVVQVPGRYSS---- 83
            |:.:| .||..||..:|..|                  :::.::::|....:.|:.|:.|:    
Human   138 LLNQT-TAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKR 201

  Fly    84 --------KEDPLAVLSERLNLLLERLNQEERISTNL---LELKEWSTKVCQEPSPS----QTLP 133
                    :|:..::||::.. ||..|:::....||:   |.....::.:.|:...|    ..|.
Human   202 LQALETKQQEELASILSKKAK-LLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLL 265

  Fly   134 KELTEEKDEPKVDFY----QPAKSDCHELD-EGVRVDGVYRFLVPERNEVQRDLYERYCAFATDG 193
            :.|.:|:.......:    :....||.|:. .|....|||...|....:.::    .:|...:.|
Human   266 RHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRK----VFCDLQSSG 326

  Fly   194 PAWTVIQSR-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGE 257
            ..||:||.| .|:.    ||.|:|.:|:.|||:.:.:.|.|||..|::..|..:.||:|||    
Human   327 GRWTLIQRRENGTV----NFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQ---- 383

  Fly   258 PLDW------AEYPLFWLDSESYNYQLSVAGEFRGSL--PDALEQHNRMDFSTYDRRRNHAKSAD 314
              ||      |:|..|.|.||:..|:|||.| :.||.  ..:|...| ..|||.|...:|..   
Human   384 --DWEGHEAYAQYEHFHLGSENQLYRLSVVG-YSGSAGRQSSLVLQN-TSFSTLDSDNDHCL--- 441

  Fly   315 STCGEDYGGGWWFDRCTQCNLNGEHGVHQRA------SPAIIWMNWRTGTDKPKSSRMMIRPVN 372
            ..|.:...||||||.|...|||   ||:..|      ...|.|..::..:...::|||||||::
Human   442 CKCAQVMSGGWWFDACGLSNLN---GVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLD 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 79/236 (33%)
ANGPT4NP_057069.1 FReD 288..501 CDD:238040 79/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.