DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and col11a2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001005799.1 Gene:col11a2 / 448277 XenbaseID:XB-GENE-12564499 Length:340 Species:Xenopus tropicalis


Alignment Length:224 Identity:74/224 - (33%)
Similarity:102/224 - (45%) Gaps:15/224 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AKSDCHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHENFN 213
            |..:|.| |:.||...|.|...:.....:     :..|...|||..|.|.|.| .||.|    |.
 Frog   126 AAKNCMELLNYGVLFTGWYTIYLDGNKPI-----KVLCDMDTDGGGWIVFQRRVDGSVD----FY 181

  Fly   214 RSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQL 278
            |.|..|:.|||:...:||.|||..|::....:.:||.:|::......:|.|..|.|:.||.||.|
 Frog   182 RDWKSYKQGFGSQLSEFWLGNENIHRLTSSGNFQLRFDLEDFDNNRTYATYSQFRLEPESQNYTL 246

  Fly   279 SVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH--GV 341
            .......|...|:|..|....|||.|...:.|  :.:.|.|.|.|.||::.|....||||:  |.
 Frog   247 RFREFTGGPAGDSLFTHKDRAFSTKDADNDPA--SKTNCAERYKGAWWYESCYHSCLNGEYMRGQ 309

  Fly   342 HQRASPAIIWMNWRTGTDKPKSSRMMIRP 370
            |.:|...:.|..:|......|.|.|.:||
 Frog   310 HDKADGGVHWAKFRGVNYSLKVSEMKLRP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 74/224 (33%)
col11a2NP_001005799.1 Collagen 45..110 CDD:189968
FReD 128..338 CDD:238040 71/220 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.