DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and MFAP4

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001185624.1 Gene:MFAP4 / 4239 HGNCID:7035 Length:279 Species:Homo sapiens


Alignment Length:229 Identity:70/229 - (30%)
Similarity:107/229 - (46%) Gaps:20/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QPAKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF 212
            ||.  ||.:: .:|.:.|||| .:.|....|...:   :|...|:|..|||.|.|   |:...:|
Human    61 QPL--DCDDIYAQGYQSDGVY-LIYPSGPSVPVPV---FCDMTTEGGKWTVFQKR---FNGSVSF 116

  Fly   213 NRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWL-----DSE 272
            .|.|::|:.|||....::|.|.:..|.:..:..:|||::|::......:|:|..|.:     .:|
Human   117 FRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAE 181

  Fly   273 SYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNG 337
            ...|.|.|||...|...|:|..|:...|||:||.::   .....|.....|.:||..|...||||
Human   182 EDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQD---LFVQNCAALSSGAFWFRSCHFANLNG 243

  Fly   338 EH--GVHQRASPAIIWMNWRTGTDKPKSSRMMIR 369
            .:  |.|...:..|.|..|:......|.:.|.||
Human   244 FYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 69/228 (30%)
MFAP4NP_001185624.1 FReD 60..278 CDD:238040 70/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.