DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and CG10359

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster


Alignment Length:369 Identity:91/369 - (24%)
Similarity:143/369 - (38%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TGSLNRIGNSDIGFKS-LEELVLIRKTLAAQALKLRGLEINLHRVLSKVVLLADAVVQVPG-RYS 82
            :..:.....|::...| |:.|..:   ||:.||.:|.:::.:.. ||:.:.....::|..| |.:
  Fly   186 SSGIGTFNESNLNLSSRLDALATL---LASTALSVRSVQVEVAN-LSRAIRRQSRLIQGKGLRST 246

  Fly    83 SKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDF 147
            ..:.|:......||                            .|:.::.||              
  Fly   247 PGQQPIFYGPSGLN----------------------------GPTATRQLP-------------- 269

  Fly   148 YQPAKSDCHELDEGVRVDGVYRF----------LVPERNEVQRDLYERYCAFATDGPAWTVIQSR 202
                 |.|.           |.|          |.||....       |.:...|   ||||.||
  Fly   270 -----SSCS-----------YSFLSNHGILKVQLTPESESF-------YVSCDED---WTVILSR 308

  Fly   203 GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLF 267
            ...   ..||.|.|.:||.|||||:.||:.|....|.:.....|||||.:::....:.:|.|.||
  Fly   309 TSD---DVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLF 370

  Fly   268 WLDSESYNYQLSVAGEFRGSLP----DALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFD 328
            .:.||...|.|.:.|:|:.:|.    |:|..|....|||.|:..::.  .:..|...:.|..||:
  Fly   371 AIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNC--LECNCALRHKGAGWFN 433

  Fly   329 RCTQCNLNGEHGVHQRASPAIIWMNWRTGTDKPKSSRMMIRPVN 372
            .|.:.||.||:....:.....||.:..:|.:..|..|.||||::
  Fly   434 NCAKSNLFGEYTTQNQPGETGIWWDTFSGQNSLKRVRWMIRPIS 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 70/234 (30%)
CG10359NP_001137882.1 FReD 267..476 CDD:238040 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446492
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.